Clone Name | rbastl18a09 |
---|---|
Clone Library Name | barley_pub |
>DAAA_STAES (Q8CS41) D-alanine aminotransferase (EC 2.6.1.21) (D-aspartate| aminotransferase) (D-amino acid aminotransferase) (D-amino acid transaminase) (DAAT) Length = 282 Score = 30.4 bits (67), Expect = 2.1 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 308 VNKMALGSVTRRVVRLVCEELGVPVPDE-FSVAGEKGPDMVLNLAPPAE 165 VN L +TRRV++ + E+ +P +E F+V K D V+ + AE Sbjct: 197 VNNFILNGITRRVIKWIAEDEQIPFKEEKFTVEFLKSADEVIISSTSAE 245
>DAAA_STAEQ (Q5HNG0) D-alanine aminotransferase (EC 2.6.1.21) (D-aspartate| aminotransferase) (D-amino acid aminotransferase) (D-amino acid transaminase) (DAAT) Length = 282 Score = 30.4 bits (67), Expect = 2.1 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -2 Query: 308 VNKMALGSVTRRVVRLVCEELGVPVPDE-FSVAGEKGPDMVLNLAPPAE 165 VN L +TRRV++ + E+ +P +E F+V K D V+ + AE Sbjct: 197 VNNFILNGITRRVIKWIAEDEQIPFKEEKFTVEFLKSADEVIISSTSAE 245
>GLI2_HUMAN (P10070) Zinc finger protein GLI2 (Tax helper protein)| Length = 1258 Score = 29.3 bits (64), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 195 VGPLLPGDGELVGHRHAQLLTH*PHHAPRDGPQR 296 +GP DG GH HA PH AP G +R Sbjct: 607 LGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGTRR 640
>GID_BACSK (Q5WFP8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 436 Score = 28.9 bits (63), Expect = 6.0 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -3 Query: 166 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 8 + L C +L+G +L N V +L H D + G + +D +D Sbjct: 50 AELVCSNSLRGNSLANAVGVLKEEMRHLDSVIIKAADEAAVPAGGALAVDRHD 102
>GLI3_XENLA (Q91660) Zinc finger protein GLI3 (Neural-specific DNA-binding| protein xGLI3) (xGLI-3) Length = 1569 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 283 TDPSAILFTVTAMANPCSGSQNPFDPPIP 369 T P F ++ NP S S +PF PP P Sbjct: 168 TYPDLPFFRISPHRNPASASDSPFSPPHP 196
>GID_STAES (Q8CPH2) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -3 Query: 166 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 8 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>GID_STAEQ (Q5HPU1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -3 Query: 166 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 8 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,235,113 Number of Sequences: 219361 Number of extensions: 1066271 Number of successful extensions: 3319 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3315 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)