Clone Name | rbastl18a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) ... | 30 | 2.6 | 2 | ACSA_BRAJA (Q89WV5) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (A... | 29 | 5.8 | 3 | NUOB_AQUAE (O67334) NADH-quinone oxidoreductase chain B (EC 1.6.... | 28 | 9.9 | 4 | GABD_DEIRA (O32507) Succinate-semialdehyde dehydrogenase [NADP+]... | 28 | 9.9 |
---|
>RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) (RAD51-like| protein 1) Length = 350 Score = 30.0 bits (66), Expect = 2.6 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 348 STLVCALRQVDISLHAGVPDRSSSQYLGDPHCVPQHFSLL 229 ST +CAL D +LH GVP S ++ G P C F ++ Sbjct: 84 STTLCAL---DEALHGGVPCGSLTEITGPPGCGKTQFCIM 120
>ACSA_BRAJA (Q89WV5) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 648 Score = 28.9 bits (63), Expect = 5.8 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +1 Query: 28 PSYHSNPKFFDITQTVHSSHIFFTNGSPLRLTFRGGPVELKATNAMNLK 174 P+Y N +F+++ H + F+T + +R +GG +K T+ +L+ Sbjct: 331 PNYPDNSRFWNVIDK-HKVNTFYTAPTAIRALMQGGDEPVKKTSRASLR 378
>NUOB_AQUAE (O67334) NADH-quinone oxidoreductase chain B (EC 1.6.99.5) (NADH| dehydrogenase I, chain B) (NDH-1, chain B) Length = 179 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 416 LLVKLRTDVNRVTPMVETVLEKL--PRWCAPFGKSTS 312 +L+ T VN+V PM++ + +++ P+WC G S Sbjct: 66 VLIVAGTVVNKVAPMLKLIWDQMPDPKWCISMGGCAS 102
>GABD_DEIRA (O32507) Succinate-semialdehyde dehydrogenase [NADP+] (EC 1.2.1.16)| (SSDH) Length = 477 Score = 28.1 bits (61), Expect = 9.9 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 244 LGNAMRVA*IL-TGRAVRNASV*GDVDLPKGAHQRGSFSRTVSTIGVTLFTS 396 L A RVA L TG N DLP G +R F R +S++G+ FT+ Sbjct: 408 LDRAQRVAERLDTGMVWINHPTSSAADLPFGGVKRSGFGRELSSMGMLEFTN 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,765,139 Number of Sequences: 219361 Number of extensions: 1106183 Number of successful extensions: 2537 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2534 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)