Clone Name | rbastl18a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | URED_SYNY3 (P73047) Urease accessory protein ureD | 28 | 7.0 | 2 | Y1356_MYCBO (P64806) Hypothetical protein Mb1356 | 28 | 9.2 | 3 | Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1 | 28 | 9.2 |
---|
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 123 ASVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 1 ++V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 5 STVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 27.7 bits (60), Expect = 9.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 129 PPASVDERRQWHAQSW 82 P A VD+RR WH W Sbjct: 70 PQAGVDDRRHWHTPCW 85
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 27.7 bits (60), Expect = 9.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 129 PPASVDERRQWHAQSW 82 P A VD+RR WH W Sbjct: 70 PQAGVDDRRHWHTPCW 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,905,467 Number of Sequences: 219361 Number of extensions: 194126 Number of successful extensions: 543 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)