Clone Name | rbastl18a03 |
---|---|
Clone Library Name | barley_pub |
>ENP2_HUMAN (Q9Y5L3) Ectonucleoside triphosphate diphosphohydrolase 2 (EC| 3.6.1.-) (NTPDase2) (Ecto-ATPase) (CD39 antigen-like 1) Length = 495 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = -3 Query: 294 LLGKNYITPCKLQV---DCHAATLTRLSGVNLDHVC*QK*SGLWSFPRMYC*TCLFPCLF 124 LLG Y +PC + + +++ LSG + H+C SGL+SF C F +F Sbjct: 275 LLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVF 334 Query: 123 YP 118 P Sbjct: 335 QP 336
>Y1276_MYCTU (Q11043) Hypothetical protein Rv1276c/MT1313| Length = 158 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 237 WQHGNRPGVCTVLCSSSPKASRV*FHTG 320 W N P V VLCS++ +A + HTG Sbjct: 33 WLRANLPAVDAVLCSTATRARQTLAHTG 60
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 28.5 bits (62), Expect = 4.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 66 CTHGTWMVEEAGYMQCYL*TSP 1 C HG W ++EAGY + +P Sbjct: 576 CVHGVWAIKEAGYKSIIINNNP 597
>DRS1_GIBZE (Q4I830) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-)| Length = 796 Score = 28.1 bits (61), Expect = 5.3 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 1/112 (0%) Frame = +3 Query: 36 LLQPSRFHAYNDYRALATLVIRCIRSKGGKKDKETSTFSSTSLEMTKAQIIFVNKHGLS* 215 L +P+R + + + TLV +R + G++DK + + K ++I + Sbjct: 455 LNRPARVMVNSQKKTVTTLVQEFVRLRPGREDKRMGYLAHVCKNLYKERVIIFFRQKKDA 514 Query: 216 HRST*LMWQHGNRPGVCTVLCSSSPKASRV*FHTG*RSRED-RDGCALWLLA 368 HR+ + G C L S + R+ S ED RDG +LLA Sbjct: 515 HRARIIFGLLGLS---CAELHGSMNQTQRI------SSVEDFRDGKVAYLLA 557
>BPHF_BURCE (P37332) Biphenyl dioxygenase system ferredoxin subunit| Length = 109 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 90 ELQVLCSHCTHGTWMVEEAGYMQ 22 EL CTHG W + + GY++ Sbjct: 35 ELFATQDRCTHGDWSLSDGGYLE 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,567,279 Number of Sequences: 219361 Number of extensions: 1099466 Number of successful extensions: 2391 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2391 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)