| Clone Name | rbastl17h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineraliz... | 30 | 2.2 | 2 | PT1_MYCGE (P47668) Phosphoenolpyruvate-protein phosphotransferas... | 28 | 8.5 |
|---|
>PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineralization protein)| Length = 416 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 115 QNWVHACGDRLCTTLQTMQ 171 QN + ACGDRLC TL Q Sbjct: 67 QNRIRACGDRLCLTLSRAQ 85
>PT1_MYCGE (P47668) Phosphoenolpyruvate-protein phosphotransferase (EC| 2.7.3.9) (Phosphotransferase system, enzyme I) Length = 572 Score = 27.7 bits (60), Expect = 8.5 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = +1 Query: 43 YMVYSIHDGLMALCNRVRPSRKINQNWVHACGDRLCTTLQTMQYVSPL*SGLDLPSAS 216 Y+ ++ L+ L V K+N W CG+ + + QY PL GL L S Sbjct: 468 YLYQPLNPALLRLIKLVVEGGKLNNVWTGMCGE-----MASDQYAIPLLLGLGLTELS 520 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,406,014 Number of Sequences: 219361 Number of extensions: 620444 Number of successful extensions: 1103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)