Clone Name | rbastl17h07 |
---|---|
Clone Library Name | barley_pub |
>PANK2_ARATH (Q8L5Y9) Pantothenate kinase 2 (EC 2.7.1.33) (Pantothenic acid kinase| 2) Length = 870 Score = 97.4 bits (241), Expect = 7e-21 Identities = 46/69 (66%), Positives = 53/69 (76%) Frame = -3 Query: 393 RQVSSEXXXXXXXXXXXXLEGMGRSLHTNLNARFKCDALKLAMVKNQRLAEKLFNGNIYD 214 RQVSSE LEGMGR+LHTN NA+F+C+ALKLAMVKNQRLAEKL GNIYD Sbjct: 801 RQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFQCEALKLAMVKNQRLAEKLIKGNIYD 860 Query: 213 CICKFEPVS 187 C+C++EP S Sbjct: 861 CVCRYEPPS 869
>Y2734_ARATH (Q949P3) Protein At2g17340| Length = 367 Score = 61.2 bits (147), Expect = 6e-10 Identities = 31/67 (46%), Positives = 41/67 (61%) Frame = -3 Query: 390 QVSSEXXXXXXXXXXXXLEGMGRSLHTNLNARFKCDALKLAMVKNQRLAEKLFNGNIYDC 211 +VS E +EGMGR + TNL A+FKCD+LK+ MVK+ +AE L G +YDC Sbjct: 300 RVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAEFL-GGRLYDC 358 Query: 210 ICKFEPV 190 + KF V Sbjct: 359 VFKFNEV 365
>PANK4_RAT (Q923S8) Pantothenate kinase 4 (EC 2.7.1.33) (Pantothenic acid| kinase 4) (rPanK4) Length = 773 Score = 52.8 bits (125), Expect = 2e-07 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = -3 Query: 336 EGMGRSLHTNLNARFKCDALKLAMVKNQRLAEKLFNGNIYDCICKFE 196 EGMGR++HTN +A +C++LKLA+VKN LAE+L G ++ I K+E Sbjct: 724 EGMGRAVHTNYHALLRCESLKLAVVKNAWLAERL-GGQLFSVIFKYE 769
>PANK4_HUMAN (Q9NVE7) Pantothenate kinase 4 (EC 2.7.1.33) (Pantothenic acid| kinase 4) (hPanK4) Length = 773 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -3 Query: 336 EGMGRSLHTNLNARFKCDALKLAMVKNQRLAEKLFNGNIYDCICKFE 196 EGMGR++HTN +A +C++LKLA++KN LAE+L G ++ I K+E Sbjct: 724 EGMGRAVHTNYHAALRCESLKLAVIKNAWLAERL-GGRLFSVIFKYE 769
>MAST2_HUMAN (Q6P0Q8) Microtubule-associated serine/threonine-protein kinase 2| (EC 2.7.11.1) Length = 1798 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 13/70 (18%) Frame = +3 Query: 234 KASLPTSGSSPSQASEHRT*NGHSGWYAVTAP-------------CPLRSTDQHPWRQLQ 374 K+ + TS +SP+ H +GH+G + +P P R TD W Sbjct: 174 KSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTDGRRWSLAS 233 Query: 375 APS*PAGINT 404 PS G NT Sbjct: 234 LPSSGYGTNT 243
>MAST2_MOUSE (Q60592) Microtubule-associated serine/threonine-protein kinase 2| (EC 2.7.11.1) Length = 1734 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 13/70 (18%) Frame = +3 Query: 234 KASLPTSGSSPSQASEHRT*NGHSGWYAVTAP-------------CPLRSTDQHPWRQLQ 374 K+ + TS +SP+ H +GH+G + +P P R TD W Sbjct: 114 KSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTDGRRWSLAS 173 Query: 375 APS*PAGINT 404 PS G NT Sbjct: 174 LPSSGYGTNT 183
>MATK_BRASC (O98634) Maturase K (Intron maturase)| Length = 500 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 318 LHTNLNARFKCDALKLAMVKNQRLAEKLFNGNIYDC 211 LH + N K ++NQRL L+N ++Y+C Sbjct: 182 LHEHHNCNSPITPKKCISIENQRLFLFLYNSHVYEC 217
>ERBB3_HUMAN (P21860) Receptor tyrosine-protein kinase erbB-3 precursor (EC| 2.7.10.1) (c-erbB3) (Tyrosine kinase-type cell surface receptor HER3) Length = 1342 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +3 Query: 243 LPTSGSSPSQASEH----RT*NGHSGWYAVTAPCPLRSTDQHPWRQLQAP 380 +PT+G++P + E+ R G G YA CP R Q P Sbjct: 1249 MPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGP 1298
>EPHB6_MOUSE (O08644) Ephrin type-B receptor 6 precursor (Tyrosine-protein| kinase-defective receptor EPH-6) (MEP) Length = 1014 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 250 VGREAFQRKHIRLHL*IRAC 191 V R QR HIRLH +RAC Sbjct: 96 VERRGAQRAHIRLHFSVRAC 115
>EPHB6_HUMAN (O15197) Ephrin type-B receptor 6 precursor (Tyrosine-protein| kinase-defective receptor EPH-6) (HEP) Length = 1006 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 250 VGREAFQRKHIRLHL*IRAC 191 V R QR HIRLH +RAC Sbjct: 80 VERRGAQRAHIRLHFSVRAC 99
>EPHB6_RAT (P0C0K7) Ephrin type-B receptor 6 precursor (Tyrosine-protein| kinase-defective receptor EPH-6) Length = 1013 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 250 VGREAFQRKHIRLHL*IRAC 191 V R QR HIRLH +RAC Sbjct: 95 VERRGAQRAHIRLHFSVRAC 114
>EPHB6_PANTR (P0C0K6) Ephrin type-B receptor 6 precursor (Tyrosine-protein| kinase-defective receptor EPH-6) Length = 1005 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 250 VGREAFQRKHIRLHL*IRAC 191 V R QR HIRLH +RAC Sbjct: 80 VERRGAQRAHIRLHFSVRAC 99
>LY10_HUMAN (Q13342) Nuclear body protein SP140 (Nuclear autoantigen Sp-140)| (Speckled 140 kDa) (LYSp100 protein) (Lymphoid-restricted homolog of Sp100) Length = 882 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 283 CSEACDGEEPEVGREAFQR 227 CSE CDGEEP+ + R Sbjct: 331 CSEMCDGEEPQEASSSLAR 349
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 262 HHRKLQSIALETGIQVGMQ*PPHAL*DQQISILGGSC--KLRANLPES 399 HH L+SI TG++ + P A + + G C LRANL E+ Sbjct: 233 HHDILRSIQTRTGLRGILSTMPTAATRDHVRLAGAKCALALRANLAEA 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,984,579 Number of Sequences: 219361 Number of extensions: 1077055 Number of successful extensions: 2355 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2355 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)