Clone Name | rbastl17h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PPB_GADMO (P83456) Alkaline phosphatase (EC 3.1.3.1) (AP) | 28 | 4.9 | 2 | YLK1_CAEEL (P41949) Hypothetical protein D1044.1 | 28 | 6.3 | 3 | YVKB_VACCC (P20570) Hypothetical 9.0 kDa protein | 28 | 8.3 |
---|
>PPB_GADMO (P83456) Alkaline phosphatase (EC 3.1.3.1) (AP)| Length = 477 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = +1 Query: 13 GRITRGSTSQGGHQTIHLKDEITKAEGRNVALTKTXXXXXXXXXXXXHICSFQG 174 GRI G Q IH E+ +A GR +T T H+ SF G Sbjct: 317 GRIDHGHHEGKDKQAIHEAVEMDRAIGRADLMTSTSDTLTVVTADHSHLFSFGG 370
>YLK1_CAEEL (P41949) Hypothetical protein D1044.1| Length = 382 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 236 AYYRMLFKSSTQIERLCMIEVPWKLQICRGKQQEDG 129 AY RML + E+LC E+ ++Q + EDG Sbjct: 193 AYIRMLHNDTLDFEKLCPAELSGRIQEVKHAFDEDG 228
>YVKB_VACCC (P20570) Hypothetical 9.0 kDa protein| Length = 79 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 125 FCHLPVAYPYIFVVSRVLLSCIV 193 +CH+P+ Y + + RVLLS I+ Sbjct: 24 YCHVPLKYIVLMIAHRVLLSSIL 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,591,947 Number of Sequences: 219361 Number of extensions: 405963 Number of successful extensions: 761 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)