ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl17g09 |
|---|---|
| Clone Library Name | barley_pub |
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 32.0 bits (71), Expect = 0.41 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVERDHCISRGH 160 + R+ PE ++L TPTQ F +HR+ +K+A + KG E + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 30.8 bits (68), Expect = 0.90 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVERDH 142 + R+ PE ++L TPTQ F +HR+ K+A + KG+E H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVE 133 + R+ PE ++L TPTQ F +HR+ K+A S KG+E Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGME 134
>NKX22_MOUSE (P42586) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVE 133 + R+ PE ++L TPTQ F +HR+ K+A + KG+E Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGME 193
>NKX22_MESAU (P43697) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVE 133 + R+ PE ++L TPTQ F +HR+ K+A + KG+E Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGME 193
>NKX22_HUMAN (O95096) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVE 133 + R+ PE ++L TPTQ F +HR+ K+A + KG+E Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGME 193
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 244 NVQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 137 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 244 NVQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 137 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 123 FHDEAFFDKKRWCKNRCEVC 64 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 149 RCNDLSQLPSMMRPFLTKNGGVRIDVKFVL 60 RC+ QL + RP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 111 AFFDKKRWCKNRCEV 67 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 111 AFFDKKRWCKNRCEV 67 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>TRUA_SYNEL (Q8CWM6) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 284 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 74 HLFLHHRFLSKKASSWKGVERDHCISRGH*LKIHLQS 184 HL HR S +A SW V+ C RG ++I +Q+ Sbjct: 163 HLSAFHRSGSNRAHSWVEVQAVSCQRRGALVEIEVQA 199
>ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 797 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 44 YLNP-TPTQTSHLFLHHRFLSKKASSWKGVERD 139 YL P TP T H F ++ +W+GV+RD Sbjct: 150 YLQPRTPGDTKDFPTHEIFRMEQLFTWRGVQRD 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,058,098 Number of Sequences: 219361 Number of extensions: 608905 Number of successful extensions: 1732 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
