Clone Name | rbastl17f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MDR1_ARATH (Q9ZR72) Multidrug resistance protein 1 (P-glycoprote... | 32 | 0.43 | 2 | ATF1_YEAST (P40353) Alcohol O-acetyltransferase 1 (EC 2.3.1.84) ... | 31 | 0.73 | 3 | LIE2_STREX (P83913) Leupeptin-inactivating enzyme 2 precursor (E... | 29 | 2.8 |
---|
>MDR1_ARATH (Q9ZR72) Multidrug resistance protein 1 (P-glycoprotein 1) (AtPgp1)| Length = 1286 Score = 32.0 bits (71), Expect = 0.43 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +2 Query: 8 PTIASH*IHQKMHQTGVSGEKPNTHACMGTMLTGECLLNKMAMFHFSHKG----IQSSPM 175 P + + + QKM TG SG+ HA GT L GE + N + F+ + + ++ + Sbjct: 854 PVVVAATVLQKMFMTGFSGDLEAAHA-KGTQLAGEAIANVRTVAAFNSEAKIVRLYTANL 912 Query: 176 SPQLPR 193 P L R Sbjct: 913 EPPLKR 918
>ATF1_YEAST (P40353) Alcohol O-acetyltransferase 1 (EC 2.3.1.84) (AATase 1)| Length = 525 Score = 31.2 bits (69), Expect = 0.73 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 101 TLCPYMHVCWVSRLTHLFGAFFGGFNAMQWL 9 T+ P++HVCW L H +G FF N +WL Sbjct: 314 TITPFLHVCWFVSL-HKWGKFFKPLN-FEWL 342
>LIE2_STREX (P83913) Leupeptin-inactivating enzyme 2 precursor (EC 3.4.24.-)| (LIE2) Length = 1090 Score = 29.3 bits (64), Expect = 2.8 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +2 Query: 50 TGVSGEKPNTHACMGTMLTGECLLNKMAMFHFSHKGIQSSPMSPQLPRLEGGSLASPITS 229 T G KPN+ C GT LTG + N +F + +++S MS + R S A + + Sbjct: 429 TSPGGGKPNSSTCNGTSLTGVGVQNAGKIF-YGGMLLKTSSMSYKKYRTATLSSAKSLDA 487 Query: 230 MLSLF 244 LF Sbjct: 488 TCDLF 492 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,549,688 Number of Sequences: 219361 Number of extensions: 794554 Number of successful extensions: 2007 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2007 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)