Clone Name | rbastl17f05 |
---|---|
Clone Library Name | barley_pub |
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 273 EQGVEFISFDGAKGEWKFRVKHFSSYGFGEAEAD 172 +QG +F + G W F+V HFS YG +++ + Sbjct: 858 KQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEE 891
>NUP98_RAT (P49793) Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98| kDa nucleoporin) Length = 937 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 273 EQGVEFISFDGAKGEWKFRVKHFSSYGFGEAEAD 172 +QG +F + G W F+V HFS YG +++ + Sbjct: 857 KQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEE 890
>NU189_SCHPO (Q9UTK4) Nucleoporin nup189 (Nuclear pore protein nup189)| Length = 1778 Score = 30.8 bits (68), Expect = 0.94 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 261 EFISFDGAKGEWKFRVKHFSSYGFGEAEAD 172 EFI F+ G+W F+V+HFS YG + E + Sbjct: 918 EFIDFND--GKWIFKVQHFSRYGLLDDEEE 945
>VGLG_BRSV4 (O10684) Major surface glycoprotein G (Attachment glycoprotein G)| Length = 263 Score = 29.3 bits (64), Expect = 2.7 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 3 EGTHSSIQRTKASQPIFSQTRSATSTKAT*NRVFTNHPKEAAITTPIDKATRNQP 167 + TH+SIQ T SQP T S T+ NR T + K + +TP+ ATR P Sbjct: 97 KSTHTSIQSTTLSQPPNIDTTSGTTYGHPTNR--TQNRKIKSQSTPL--ATRKPP 147
>VGLG_BRSV1 (O10683) Major surface glycoprotein G (Attachment glycoprotein G)| Length = 263 Score = 29.3 bits (64), Expect = 2.7 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 3 EGTHSSIQRTKASQPIFSQTRSATSTKAT*NRVFTNHPKEAAITTPIDKATRNQP 167 + TH+SIQ T SQP T S T+ NR T + K + +TP+ ATR P Sbjct: 97 KSTHTSIQSTTLSQPPNIDTTSGTTYGHPTNR--TQNRKIKSQSTPL--ATRKPP 147
>BORG2_MOUSE (Q9CQC5) Cdc42 effector protein 3 (Binder of Rho GTPases 2)| Length = 254 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 49 YSPRPDQLHRPKLHRIECSPIIQKRQQLQHLSIKLQGISQG 171 + + + RPKL R+ C P+++++ Q Q ++ + QG Sbjct: 128 FHSKQESFGRPKLPRLSCEPVMEEKVQEQSSLLENGAVHQG 168
>NU145_YEAST (P49687) Nucleoporin NUP145 precursor (EC 3.4.21.-) (Nuclear pore| protein NUP145) [Contains: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)] Length = 1317 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 264 VEFISFDGAKGEWKFRVKHFSSYGF-GEAEADPLADSL 154 + +IS++ G W F+V HFS +G E +A+ D L Sbjct: 586 MNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEIDEDDL 623
>ABDB_DROME (P09087) Homeobox protein abdominal-B (P3) (Infraabdominal 7)| (IAB-7) (PH189) Length = 493 Score = 28.5 bits (62), Expect = 4.6 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 7/85 (8%) Frame = +1 Query: 28 EQKHHNQYSPRPDQLHRPKLHRIECSPIIQKRQQLQHL-------SIKLQGISQGVGFGF 186 +Q HH+ + P LH H + Q++QQ QH S+ Q Q Sbjct: 29 QQLHHHAHHHLPQPLHTTSHHHSAHPHLQQQQQQQQHAVVASSPSSVLQQQQQQSTPTTH 88 Query: 187 TKPVGAEVLHSELPLALGAIKRDKL 261 + P A + P+ L A+++ L Sbjct: 89 STPTHAVMYEDPPPVPLVAVQQQHL 113
>CXI8_CONRA (Q7Z091) I-superfamily conotoxin R11.8 (r11d)| Length = 41 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 158 PCSFIDRCCNCCL 120 PCS+ CCNCCL Sbjct: 8 PCSYHADCCNCCL 20
>CXI17_CONRA (Q7Z093) I-superfamily conotoxin R11.17| Length = 46 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 158 PCSFIDRCCNCCL 120 PCS+ CCNCCL Sbjct: 11 PCSYHADCCNCCL 23
>CXI14_CONRA (Q7Z092) I-superfamily conotoxin R11.14 (r11b)| Length = 46 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 158 PCSFIDRCCNCCL 120 PCS+ CCNCCL Sbjct: 11 PCSYHADCCNCCL 23
>ZCHC8_MOUSE (Q9CYA6) Zinc finger CCHC domain-containing protein 8| Length = 709 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 68 SYIDQSYIESSVHQSSKRGSNYNTYR*SYKESARGSASASPNP*EL 205 SY++ + S+ S KR S+ ++ K+ GSA+ASP EL Sbjct: 403 SYLNSNIQSPSMRSSGKRSSSQSSPNSPKKQRKEGSAAASPADMEL 448
>CXI7_CONRA (Q7Z095) I-superfamily conotoxin R11.7| Length = 46 Score = 27.7 bits (60), Expect = 7.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 158 PCSFIDRCCNCCL 120 PC + CCNCCL Sbjct: 11 PCEYHSDCCNCCL 23 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,822,188 Number of Sequences: 219361 Number of extensions: 761645 Number of successful extensions: 2376 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2376 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)