Clone Name | rbastl17e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CRYD_VIBPA (Q87JP5) Cryptochrome DASH | 28 | 7.7 | 2 | SSN2_YEAST (P38931) Suppressor of RNA polymerase B SSN2 (SCA1 pr... | 27 | 10.0 | 3 | COX1_LUMTE (Q34941) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 27 | 10.0 |
---|
>CRYD_VIBPA (Q87JP5) Cryptochrome DASH| Length = 445 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -3 Query: 254 YSFRFYHFIHINGLLLVGR*LYGAVLVCTYCRPSLT 147 Y F F +H N LL V + LVC YCRPS+T Sbjct: 8 YWFTFDLRLHDNSLL-VDASSFLDELVCLYCRPSVT 42
>SSN2_YEAST (P38931) Suppressor of RNA polymerase B SSN2 (SCA1 protein)| Length = 1420 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 169 VHTRTAPYSHLPTSSNPLMWMKW*KRKLYAGCRMNSTNDALQTANCC 309 + T TA YS + +++K +RK+Y + S N +Q N C Sbjct: 90 IGTFTADYSKPNLPPHYALFLKALRRKIYINLALGSHNKLIQFGNAC 136
>COX1_LUMTE (Q34941) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 513 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -3 Query: 167 YCRPSLTAGFFSFFRCSGGNVAPLFMDDTSDLILYCVYYAAEHY 36 Y P L A F F +GG + + + D+IL+ YY H+ Sbjct: 331 YETPVLWALGFIFLFTTGGLTGIILSNSSLDIILHDTYYVVAHF 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,877,537 Number of Sequences: 219361 Number of extensions: 774971 Number of successful extensions: 1378 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1378 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)