| Clone Name | rbastl17d06 |
|---|---|
| Clone Library Name | barley_pub |
>SMBP2_HUMAN (P38935) DNA-binding protein SMUBP-2 (EC 3.6.1.-) (ATP-dependent| helicase IGHMBP2) (Immunoglobulin mu-binding protein 2) (SMUBP-2) (Glial factor 1) (GF-1) Length = 993 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 257 SSQAWKEDGKNLSQQAGRARRISGQEASAPPASGR 361 S A K G S + G R+ GQEA+AP GR Sbjct: 660 SHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGR 694
>CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Chromatin-related mesenchymal modulator) (CReMM) (Chromatin remodeling factor CHROM1) (Peroxisomal proliferator-activated receptor A-inter Length = 2897 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 231 SGRPSIVYEAPRLGRRTAKISASRQEEHGAFQARKLQRLQPVEEELDEE 377 SGR S+V + PR+ ++T SA++ E L L E E DE+ Sbjct: 1438 SGRNSLVIDTPRIRKQTRPFSATKDE---------LAELSEAESEGDEK 1477
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 28.1 bits (61), Expect = 5.4 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = -1 Query: 198 CCAPKFSNGDFVLFLSYV*CFESHSTHA*CVALCCRIFLTMLLVCR-VCIMKATSEF 31 CC P S S C +S A C + CCR ++ L+CR VC A+ F Sbjct: 197 CCVPVCSGA------SSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSF 247
>PO23_POPJA (Q05118) Retrovirus-related Pol polyprotein from type-1| retrotransposable element R2 (Retrovirus-related Pol polyprotein from type I retrotransposable element R2) [Includes: Reverse transcriptase (EC 2.7.7.49); Endonuclease] (Fragment) Length = 606 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 357 PLAGGAEASWPEMRRALPACWLRFLPSSFQAWELHTQLK 241 PL GA WP R +P C + +P++ +A +HT LK Sbjct: 543 PLLLGARGIWP--RANVPTCNILSIPTTLRASCVHTCLK 579
>GLUB7_ORYSA (Q52PJ1) Glutelin type-B 7 precursor [Contains: Glutelin type-B 7| acidic chain; Glutelin type-B 7 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 246 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 353 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483
>GLUB2_ORYSA (Q02897) Glutelin type-B 2 precursor [Contains: Glutelin type-B 2| acidic chain; Glutelin type-B 2 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 246 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 353 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483
>SAC3_MOUSE (Q91WF7) SAC domain-containing protein 3| Length = 907 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 4 KFIRIYDELKFRGSFHYAYSTN*QHSQEYTTT 99 +++RI+ + +F+++YS + HS +Y T Sbjct: 149 RYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT 180
>SAC3_HUMAN (Q92562) SAC domain-containing protein 3| Length = 907 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 4 KFIRIYDELKFRGSFHYAYSTN*QHSQEYTTT 99 +++RI+ + +F+++YS + HS +Y T Sbjct: 149 RYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT 180
>RM12_CRICR (P52827) 39S ribosomal protein L12, mitochondrial precursor (L12mt)| (MRP-L12) (P2A1) Length = 203 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 258 APRLGRRTAKISASRQEEHGAFQARKL 338 APRLG R A++ +RQ+ G AR+L Sbjct: 13 APRLGLRGARLRLARQQVPGVCAARQL 39
>KHSE_SCHPO (O43056) Probable homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 338 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +3 Query: 213 TVLPDTSGRPSIVYEAPRLGRRTAKISASRQEEHGAFQARKLQRLQPVEEEL 368 +VLP + GR +VY RL T + + H ++ K + QP L Sbjct: 213 SVLPTSYGRTDVVYNLQRLALLTTALGQTPINPHLVYEVMKDKVHQPYRASL 264
>DHCR7_BOVIN (Q5E9J5) 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC| reductase) (Sterol delta-7-reductase) Length = 475 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 286 KSQPAG--RKSTAHFRPGSFSASSQWKRSW 369 KSQP+ KST+ G+ +A QW R+W Sbjct: 4 KSQPSAPKTKSTSGLTNGNAAAQGQWGRAW 33
>LMNB1_MOUSE (P14733) Lamin-B1| Length = 587 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/90 (22%), Positives = 42/90 (46%) Frame = +3 Query: 108 HIMHEYCDSQNIKHN*EIVQSLHSKI*VRNKQIQVTVLPDTSGRPSIVYEAPRLGRRTAK 287 H M E D+Q + E+ Q+ H+K+ ++ S R ++ R+ +++ Sbjct: 247 HEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQ 306 Query: 288 ISASRQEEHGAFQARKLQRLQPVEEELDEE 377 +S ++E L+R+Q +E+ L +E Sbjct: 307 LSNLQKESRAC-----LERIQELEDMLAKE 331
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -1 Query: 207 EFACCAPKFSNGDFVLFLSYV*CFESHSTHA*CVALCCRIFLTMLLVCR-VC 55 + ACC P S S C +S A C A CCR ++ L+C VC Sbjct: 267 QHACCVPVCSGA------STSCCQQSSCQPACCTASCCRSSSSVSLLCHPVC 312 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,390,188 Number of Sequences: 219361 Number of extensions: 1133368 Number of successful extensions: 3118 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3117 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)