Clone Name | rbastl17d01 |
---|---|
Clone Library Name | barley_pub |
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +2 Query: 101 QYKSSRICIT-HKRNTTISQ---ITQPIRSTNKCTYMMKLLLFS 220 Q+KS+ C+T HK++ T ++ P+ ST+KCT L LFS Sbjct: 929 QFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 972
>ENDR_PAEPO (P27871) Probable HTH-type transcriptional regulator endR| Length = 340 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +1 Query: 127 YTQKKYHYQSNNTTNKINQQM----YIYDEAAALLHQ 225 + QK+Y+Y S NT KI Q + YI +E A L Q Sbjct: 22 FLQKRYNYMSENTKKKIEQAIEDLSYIPNEVARSLKQ 58
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +2 Query: 101 QYKSSRICITHKRNTTISQ----ITQPIRSTNKCTYMMKLLLFS 220 Q+KS+ C+T +R + + ++ P+ ST+KCT L LFS Sbjct: 891 QFKSTVQCLTCRRRSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 934
>LFTR_XYLFT (Q87DL5) Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)| (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) Length = 243 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 36 VATGDKYNRSSFFQIHTAVARSNTSQVGYVLHTKEIPL 149 VA G + S F H ++ + + Y LHT +PL Sbjct: 153 VAIGRMFFGESMFSTHNGASKIALASLAYFLHTHSVPL 190
>ARID2_HUMAN (Q68CP9) AT-rich interactive domain-containing protein 2 (ARID| domain-containing protein 2) (BRG1-associated factor 200) (BAF200) Length = 1835 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +3 Query: 3 DPNQHELHLTSVATGDKYNRSSFFQIHTAVARSNTSQVGYVLHTKEIPL 149 D ++E+H+ S+ G KY+ SS ++ +S T+Q + + + L Sbjct: 1282 DTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCSLISNGPSLEL 1330
>STP22_YEAST (P25604) Suppressor protein STP22 of temperature-sensitive| alpha-factor receptor and arginine permease (Vacuolar protein sorting-associated protein VPS23) Length = 385 Score = 27.3 bits (59), Expect = 9.2 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +2 Query: 284 IKQGREMSASRYLI*WHL 337 +KQGRE++ ++L+ WH+ Sbjct: 360 VKQGRELARQQFLVRWHI 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,912,746 Number of Sequences: 219361 Number of extensions: 889844 Number of successful extensions: 2265 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2264 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)