ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl17c10 |
|---|---|
| Clone Library Name | barley_pub |
>NU4M_LOCMI (Q36424) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 444 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -3 Query: 290 MPFICCHSMN*PWWGSFWSLY*CIGVVRVIQGFVNGRSGLFCL 162 M + C M WWG C+G + ++ G SGLFCL Sbjct: 282 MSLVICGLMTMNWWG-------CMGSLSLMIGHGISSSGLFCL 317
>NU5M_TRYBB (P04540) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 590 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 194 FVNGRSGLFCLVSALMMSQTSVCPIITF-----CLELLVYLIRVVLYFVDFFFLTLNYTC 30 F+ GR+ L +S +M+ +C I +F CL Y ++ +DF F+ L Y C Sbjct: 19 FMFGRNFLSFWLSLVMIIFIVLCMIFSFLMVSVCLYGYYYYDFCLILMLDFCFIWLTYVC 78 Query: 29 S 27 S Sbjct: 79 S 79
>O51T1_HUMAN (Q8NGJ9) Olfactory receptor 51T1| Length = 327 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -3 Query: 287 PFICCHSMN*PWWGSFWSLY*CIGVVRVIQGFVNGRSGLFCLVSALMMSQT 135 P + ++ + PW SFW L+ +Q ++NG LF L S +++ +T Sbjct: 184 PEVIKYTYSKPWISSFWGLF--------LQLYLNGTDVLFILFSYVLILRT 226
>POLG_DEN2H (P29984) Genome polyprotein [Contains: Envelope protein M (Matrix| protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 555 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P++ P ++Q F+C HSM WG+ L+ G+V Sbjct: 121 SRCPIQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 163
>FKBP9_RAT (Q66H94) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) Length = 570 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) Length = 570 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>FKBP9_HUMAN (O95302) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) Length = 570 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 165 SCVRTDDVSDFSLSHHHFLFGIARLFDSS 79 SC RT VSDF H++ F LFDSS Sbjct: 158 SCPRTIQVSDFVRYHYNGTFLDGTLFDSS 186
>CNKR1_HUMAN (Q969H4) Connector enhancer of kinase suppressor of ras 1| (Connector enhancer of KSR1) (hCNK1) (Connector enhancer of KSR-like) (CNK homolog protein 1) Length = 720 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 386 PSPAKPGSEQQDWNSPARLPVEKSPK 309 PSPA+ GS SPA P ++SP+ Sbjct: 538 PSPAQAGSPLHGDTSPAATPTQRSPR 563
>UFD2_SCHPO (Q9HE05) Ubiquitin conjugation factor E4 (Ubiquitin fusion| degradation protein 2) (UB fusion protein 2) Length = 1010 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 365 SEQQDWNSPARLPVEKSPKGKKQQWMPFICCHSMN 261 SEQ++ + P K K +WM FI C ++N Sbjct: 56 SEQKEISPPVTSGAPKHRLFSKDEWMHFITCQALN 90
>POLG_DEN2U (P18356) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 679 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 252 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 294
>POLG_DEN2D (P30026) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 1127 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 352 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 394
>TBK1_MOUSE (Q9WUN2) Serine/threonine-protein kinase TBK1 (EC 2.7.11.1)| (TANK-binding kinase 1) (T2K) Length = 729 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 51 EEEINKVQDYSNQINEQFQTK 113 EEE++K QDY+N++ E K Sbjct: 641 EEEVSKYQDYTNELQETLPQK 661
>POLG_DEN2N (P14340) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 352 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 394
>POLG_DEN27 (P29991) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 352 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 394
>POLG_DEN26 (P29990) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 352 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 394
>POLG_DEN22 (P14338) Genome polyprotein [Contains: Major envelope protein E]| (Fragment) Length = 495 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 338 ARLPVEKSPKGKKQQWMPFICCHSMN*PWWGSFWSLY*CIGVV 210 +R P + P ++Q F+C HSM WG+ L+ G+V Sbjct: 72 SRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIV 114
>CKLF5_HUMAN (Q96DZ9) CKLF-like MARVEL transmembrane domain-containing protein 5| (Chemokine-like factor superfamily member 5) Length = 223 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 371 PGSEQQDWNSPARLPVEKSPKGKKQQWMP-FICCHSM 264 PG W++PA +P +P W+ FIC HS+ Sbjct: 121 PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSL 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,518,633 Number of Sequences: 219361 Number of extensions: 1007465 Number of successful extensions: 2356 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2353 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
