Clone Name | rbastl17c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RIC8A_XENLA (Q45TX8) Synembryn-A (Protein Ric-8A) | 30 | 2.1 | 2 | V2A_BBMV (P27462) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (... | 29 | 3.6 |
---|
>RIC8A_XENLA (Q45TX8) Synembryn-A (Protein Ric-8A)| Length = 539 Score = 29.6 bits (65), Expect = 2.1 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +3 Query: 6 RAKRYIDTPTRHEISIVAVIKI*MSFSTTMQLQSLLSPDN*AFQGAILTAYALETTILL- 182 R K Y +T + HE + + + + ++ ++ L+ + +G L ALE+T+ L Sbjct: 148 RLKLYNETRSSHESKFFDLRLLFLLTALSVDMRRQLAQE---LRGVSLLTDALESTLALK 204 Query: 183 YRDLYQILPAHIASSLPRIPTQ 248 + D+Y+++ H+A L + T+ Sbjct: 205 WSDIYEVVTDHLAPPLGKEETE 226
>V2A_BBMV (P27462) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 810 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 95 HCCTETHLYFDNSYYRDFMSGRGINVPFSSL 3 H +TH YFD+SYY F + F L Sbjct: 251 HNALKTHAYFDDSYYEGFEESADFSSDFQRL 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,033,854 Number of Sequences: 219361 Number of extensions: 500003 Number of successful extensions: 929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 929 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)