Clone Name | rbastl17c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 i... | 33 | 0.20 |
---|
>YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 intergenic| region Length = 396 Score = 33.1 bits (74), Expect = 0.20 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = +2 Query: 38 RLQASSNFTEQRIHFWIRDSSLVVSSSPHVTDGNQPTR*SDNDEGLKSSSELPDVAGA 211 +L +SS +IH V +SSP GNQP +N EG +SS LP + G+ Sbjct: 77 KLASSSGLPINQIHKLFNTDHGVPASSPMKAGGNQP---HNNTEGTQSSENLPRLNGS 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,398,681 Number of Sequences: 219361 Number of extensions: 515174 Number of successful extensions: 1120 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1120 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)