Clone Name | rbastl17c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RL16_PSEU2 (Q4ZMQ1) 50S ribosomal protein L16 | 29 | 3.5 | 2 | RL16_PSESM (Q889W4) 50S ribosomal protein L16 | 29 | 3.5 | 3 | RL16_PSEF5 (Q4K540) 50S ribosomal protein L16 | 29 | 3.5 | 4 | RL16_PSE14 (Q48D43) 50S ribosomal protein L16 | 29 | 3.5 | 5 | RL16_PSEPK (Q88QM8) 50S ribosomal protein L16 | 28 | 7.8 |
---|
>RL16_PSEU2 (Q4ZMQ1) 50S ribosomal protein L16| Length = 137 Score = 28.9 bits (63), Expect = 3.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 28 LYPECTSFKEQPRVHNSLLALRQNKGNATRVLLPNVHKKIPTLRVIHI*RKMMLHH 195 L P+ T F++Q HN LALR +K + L +V + T R I R+ + H Sbjct: 2 LQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKSVARGRLTARQIESARRALTRH 57
>RL16_PSESM (Q889W4) 50S ribosomal protein L16| Length = 137 Score = 28.9 bits (63), Expect = 3.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 28 LYPECTSFKEQPRVHNSLLALRQNKGNATRVLLPNVHKKIPTLRVIHI*RKMMLHH 195 L P+ T F++Q HN LALR +K + L +V + T R I R+ + H Sbjct: 2 LQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKSVARGRLTARQIESARRALTRH 57
>RL16_PSEF5 (Q4K540) 50S ribosomal protein L16| Length = 137 Score = 28.9 bits (63), Expect = 3.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 28 LYPECTSFKEQPRVHNSLLALRQNKGNATRVLLPNVHKKIPTLRVIHI*RKMMLHH 195 L P+ T F++Q HN LALR +K + L +V + T R I R+ + H Sbjct: 2 LQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKSVARGRLTARQIESARRALTRH 57
>RL16_PSE14 (Q48D43) 50S ribosomal protein L16| Length = 137 Score = 28.9 bits (63), Expect = 3.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 28 LYPECTSFKEQPRVHNSLLALRQNKGNATRVLLPNVHKKIPTLRVIHI*RKMMLHH 195 L P+ T F++Q HN LALR +K + L +V + T R I R+ + H Sbjct: 2 LQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKSVARGRLTARQIESARRALTRH 57
>RL16_PSEPK (Q88QM8) 50S ribosomal protein L16| Length = 137 Score = 27.7 bits (60), Expect = 7.8 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 28 LYPECTSFKEQPRVHNSLLALRQNKGNATRVLLPNVHKKIPTLRVIHI*RKMMLHH 195 L P+ T F++Q HN LALR +K + L V + T R I R+ + H Sbjct: 2 LQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTARQIESARRALTRH 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,234,128 Number of Sequences: 219361 Number of extensions: 851560 Number of successful extensions: 2088 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2088 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)