Clone Name | rbastl17b08 |
---|---|
Clone Library Name | barley_pub |
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 30.8 bits (68), Expect = 0.80 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +3 Query: 57 QYKSSRICIT-HKRNTTISQ---ITQPIRSTNKCTYMMKLLLFS 176 Q+KS+ C+T HK++ T ++ P+ ST+KCT L LFS Sbjct: 929 QFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 972
>ENDR_PAEPO (P27871) Probable HTH-type transcriptional regulator endR| Length = 340 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +2 Query: 83 YTQKKYHYQSNNTTNKINQQM----YIYDEAAALLHQ 181 + QK+Y+Y S NT KI Q + YI +E A L Q Sbjct: 22 FLQKRYNYMSENTKKKIEQAIEDLSYIPNEVARSLKQ 58
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +3 Query: 57 QYKSSRICITHKRNTTISQ----ITQPIRSTNKCTYMMKLLLFS 176 Q+KS+ C+T +R + + ++ P+ ST+KCT L LFS Sbjct: 891 QFKSTVQCLTCRRRSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 934
>Y913_BACHD (Q9KED9) UPF0249 protein BH0913| Length = 237 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 280 FDGTSSMCCHPSYIPPLIR 336 +DGT + CHP+YI ++R Sbjct: 191 YDGTIEIMCHPAYIDEVLR 209
>RK13_SPIOL (P12629) 50S ribosomal protein L13, chloroplast precursor (CL13)| Length = 250 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 384 QAQQNVKSSVAVPHNPSDKRW 322 Q ++ VK A+PH P D+RW Sbjct: 63 QLKEAVKKEFAIPHVPLDQRW 83
>ADH1_RANPE (P22797) Alcohol dehydrogenase 1 (EC 1.1.1.1) (Alcohol| dehydrogenase, major) Length = 375 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 356 LLFLTIHLIRGGIYDGWQHIDEVP 285 LL LT ++ G ++ GW+ D+VP Sbjct: 307 LLILTGRILTGAVFGGWKSKDDVP 330
>STP22_YEAST (P25604) Suppressor protein STP22 of temperature-sensitive| alpha-factor receptor and arginine permease (Vacuolar protein sorting-associated protein VPS23) Length = 385 Score = 27.3 bits (59), Expect = 8.8 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 240 IKQGREMSASRYLI*WHL 293 +KQGRE++ ++L+ WH+ Sbjct: 360 VKQGRELARQQFLVRWHI 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,968,763 Number of Sequences: 219361 Number of extensions: 1017290 Number of successful extensions: 2721 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2720 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)