Clone Name | rbastl17b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PEL18_LYCES (P24396) Probable pectate lyase P18 precursor (EC 4.... | 28 | 4.6 | 2 | MCR_RAT (P22199) Mineralocorticoid receptor (MR) | 28 | 7.9 |
---|
>PEL18_LYCES (P24396) Probable pectate lyase P18 precursor (EC 4.2.2.2) (Style| development-specific protein 9612) Length = 404 Score = 28.5 bits (62), Expect = 4.6 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -1 Query: 172 NLICRAMSAHQC----GGNFRENPNSSPILFIDEQDVAVIFFGASFTVRLC 32 N+I ++ H C GN R++PN S + + D IF G + V C Sbjct: 167 NIIIHGINIHDCKQSGNGNIRDSPNHSGWWDVSDGDGISIFGGKNIWVDHC 217
>MCR_RAT (P22199) Mineralocorticoid receptor (MR)| Length = 981 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 217 AKQTCSCPFLVPFLCNLICRAMSAHQCGG-NFRENPNSSPILFID 86 +K + S PF VP I + S H C G +F+ NP +P F+D Sbjct: 416 SKISPSSPFSVP-----IKQESSKHSCSGASFKGNPTVNPFPFMD 455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,465,413 Number of Sequences: 219361 Number of extensions: 770139 Number of successful extensions: 1752 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1752 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)