| Clone Name | rbastl17a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YN25_YEAST (P53831) Hypothetical 14.1 kDa protein in SEC21-MRPL1... | 30 | 2.9 | 2 | ATKA_PROAC (Q6ABJ2) Potassium-transporting ATPase A chain (EC 3.... | 28 | 8.6 | 3 | BACH2_MOUSE (P97303) Transcription regulator protein BACH2 (BTB ... | 28 | 8.6 |
|---|
>YN25_YEAST (P53831) Hypothetical 14.1 kDa protein in SEC21-MRPL10 intergenic| region Length = 123 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 72 VNVSLRLENITSQVDKFSLQENKKVQTQLVKRNENSFLSRPNTG 203 +NV + LEN ++ + KF EN+ L ++N + +RP G Sbjct: 7 INVDIILENASNAIKKFERYENRTRVPTLEGWDDNHYTNRPCVG 50
>ATKA_PROAC (Q6ABJ2) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 556 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 287 LIYRRNSVA*KGGRAVAGIEASAGWTTAA 201 L+Y S A G A AG++AS W AA Sbjct: 455 LVYAFTSAANNNGSAFAGLDASTNWLCAA 483
>BACH2_MOUSE (P97303) Transcription regulator protein BACH2 (BTB and CNC homolog| 2) Length = 716 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 84 LRLENITSQVDKFSLQENKKVQTQLVKRNENSFLSRPNTGCSRP 215 LR+ N+ F +QTQL+ R + F+ R ++ C RP Sbjct: 116 LRMHNLEDSCFSF-------LQTQLLNREDGLFVCRKDSACQRP 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,543,470 Number of Sequences: 219361 Number of extensions: 987412 Number of successful extensions: 2336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2334 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)