Clone Name | rbastl17a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | O2T11_HUMAN (Q8NH01) Olfactory receptor 2T11 (Olfactory receptor... | 29 | 3.2 | 2 | MADS2_PETHY (Q07474) Floral homeotic protein PMADS 2 | 28 | 7.1 | 3 | YOR3_YEREN (P28836) Hypothetical UPF0075 protein (ORF3) | 27 | 9.2 |
---|
>O2T11_HUMAN (Q8NH01) Olfactory receptor 2T11 (Olfactory receptor OR1-65)| Length = 316 Score = 28.9 bits (63), Expect = 3.2 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 177 SYKGGKISSYRVPSQGGSKLAWEPQNGIITSSSII*EADFYGFFRPQT-HTGRTDGRVAA 353 SY ++ +R+PS G K A+ + +T SI A FY + PQ+ HT D V+A Sbjct: 214 SYSLILLTIHRMPSAEGRKKAFTTCSSHLTVVSIFYGAAFYTYVLPQSFHTPEQDKVVSA 273
>MADS2_PETHY (Q07474) Floral homeotic protein PMADS 2| Length = 212 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 187 EGKFLLIVYHHREVLSLRGNLRMVSSHHHQ 276 E K L H +E+ ++ GN+RM+ +HQ Sbjct: 156 EHKQLQYALHQKEMAAMGGNMRMIEEVYHQ 185
>YOR3_YEREN (P28836) Hypothetical UPF0075 protein (ORF3)| Length = 125 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 283 ERLISTGFFAPKPILDGRTDVLLPVTAVCV 372 ERL+ G A P++ R LLP T VCV Sbjct: 63 ERLLVCGGGARNPLVMSRMSTLLPGTEVCV 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,771,543 Number of Sequences: 219361 Number of extensions: 861146 Number of successful extensions: 1909 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1908 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)