Clone Name | rbastl16h04 |
---|---|
Clone Library Name | barley_pub |
>HHCM_HUMAN (Q05877) Hepatocellular carcinoma protein HHCM (HHC(M))| Length = 467 Score = 29.6 bits (65), Expect = 2.4 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 19 VPPKKFAFTPFSWLLFLWHS--FYKPPPHHK*NYSATMGT*QSLW 147 VPP ++ F PFS FLWHS + PH + S GT LW Sbjct: 100 VPPNQWKFFPFS---FLWHSLALTQGSPHSR---SRHQGTGGELW 138
>STAR8_MOUSE (Q8K031) StAR-related lipid transfer protein 8 (StARD8) (START| domain-containing protein 8) Length = 1019 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 62 YFYGTHSTNPHPTTNKITLPLWGRDNPYG 148 Y Y T S PHP + + L +W D P G Sbjct: 903 YHYVTDSMAPHPCRDFVVLRMWRSDLPRG 931
>RIM_CAEEL (Q22366) Rab-3-interacting molecule unc-10 (Rim) (Uncoordinated| protein 10) Length = 1563 Score = 28.5 bits (62), Expect = 5.2 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +2 Query: 11 NQQSHQKNLPSPHSRGYYFYGT-----HSTNPHPTT 103 NQQ Q P P+ +GYY G+ HSTN PTT Sbjct: 1223 NQQMQQMQPPMPN-QGYYSDGSETLSVHSTNSMPTT 1257
>STAR8_HUMAN (Q92502) StAR-related lipid transfer protein 8 (StARD8) (START| domain-containing protein 8) Length = 1023 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 62 YFYGTHSTNPHPTTNKITLPLWGRDNPYG 148 Y Y T S PHP + + L +W D P G Sbjct: 907 YHYVTDSMAPHPCRDFVVLRMWRSDLPRG 935
>MRP5_MOUSE (Q9R1X5) Multidrug resistance-associated protein 5 (ABC transporter| MOAT-C) (SMRP) Length = 1436 Score = 27.7 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 8 INQQSHQKNLPSPHSRGYYFYGTHSTNPHPTTNKITLPL 124 I+ SH + L HS+G Y +G P TT K P+ Sbjct: 63 ISVHSHLQILDEEHSKGKYHHGLSVLKPFRTTTKHQHPV 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,450,087 Number of Sequences: 219361 Number of extensions: 557860 Number of successful extensions: 1288 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1288 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)