Clone Name | rbastl16h01 |
---|---|
Clone Library Name | barley_pub |
>HISX_GEOSL (P60859) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 429 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 294 TLDI*IALSNESRVNPEHL-CVLLSPYEKASRYKCLLSTLLGHCSPE 157 +LD IA SN R+ PEHL + +P+E R K + LGH +PE Sbjct: 313 SLDEAIAFSN--RIAPEHLELAVANPFEILPRIKNAGAIFLGHFTPE 357
>EUTR_ECOLI (P36547) HTH-type transcriptional regulator eutR (Ethanolamine| operon regulatory protein) Length = 350 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 19 GFVDRL*VTYCSQPQNLHQ 75 GFV + T+C P+NLHQ Sbjct: 184 GFVQQALATFCENPENLHQ 202
>MMP9_RAT (P50282) Matrix metalloproteinase-9 precursor (EC 3.4.24.35)| (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB) Length = 708 Score = 28.1 bits (61), Expect = 5.5 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 304 NSSREYGFAPSQSIYTVH 357 ++ R+YGF PS+++YT H Sbjct: 264 DTDRKYGFCPSENLYTEH 281
>GLGX_SHIFL (Q83J89) Glycogen debranching enzyme (EC 3.2.1.-) (Glycogen operon| protein glgX) Length = 657 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -1 Query: 176 LVTAH-----QKTVCFGGKRNEASGRSSRFSKQN 90 LVTAH + VCF K NEA+G +R N Sbjct: 438 LVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNN 471
>GLGX_ECOLI (P15067) Glycogen debranching enzyme (EC 3.2.1.-) (Glycogen operon| protein glgX) Length = 657 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -1 Query: 176 LVTAH-----QKTVCFGGKRNEASGRSSRFSKQN 90 LVTAH + VCF K NEA+G +R N Sbjct: 438 LVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNN 471
>GLGX_ECOL6 (Q8FCR8) Glycogen debranching enzyme (EC 3.2.1.-) (Glycogen operon| protein glgX) Length = 657 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -1 Query: 176 LVTAH-----QKTVCFGGKRNEASGRSSRFSKQN 90 LVTAH + VCF K NEA+G +R N Sbjct: 438 LVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNN 471
>GLGX_ECO57 (Q8X6X8) Glycogen debranching enzyme (EC 3.2.1.-) (Glycogen operon| protein glgX) Length = 657 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -1 Query: 176 LVTAH-----QKTVCFGGKRNEASGRSSRFSKQN 90 LVTAH + VCF K NEA+G +R N Sbjct: 438 LVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNN 471
>HISX_THIDN (Q30TA4) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 430 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 297 LTLDI*IALSNESRVNPEHLCVL-LSPYEKASRYKCLLSTLLGHCSPE 157 +T D+ A+ + + PEHL V LSP+E K + LGH +PE Sbjct: 310 VTSDMQEAIDLMNEIAPEHLEVATLSPFELLPLIKHAGAIFLGHNTPE 357
>RECR_MANSM (Q65SE7) Recombination protein recR| Length = 200 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Frame = -3 Query: 288 DI*IALSNESRVNPEHLCVLLSP-----YEKASRYKCLLSTLLGHCSPEDGLFRRK 136 DI N R N LCV+ P E+ ++ L+GH SP DG+ R+ Sbjct: 67 DICSICDNPRRQNSRLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGPRE 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,442,664 Number of Sequences: 219361 Number of extensions: 906712 Number of successful extensions: 1828 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1828 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)