Clone Name | rbastl16g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VC19_SWPVK (P32207) Protein C19 | 28 | 4.2 | 2 | MYC2_CRODU (Q9PWF3) Crotamine CRO2 precursor | 28 | 7.2 | 3 | DPH1_YEAST (P40487) Diphthamide biosynthesis protein 1 | 28 | 7.2 |
---|
>VC19_SWPVK (P32207) Protein C19| Length = 215 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 153 MQFYKNASCSSLISNGSLEKHSRMSNYKWFIYSRLYLST*FVVSSC 290 M N+ I N ++ + ++N WFI+S + ++ FV+ C Sbjct: 152 MNSIMNSMNRRYIDNANIYNYLNLTNRPWFIFSIIIIAIIFVIGIC 197
>MYC2_CRODU (Q9PWF3) Crotamine CRO2 precursor| Length = 65 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 19 INEWSTCYIGCHDPGYRNTIREKINLLPSS*NKFGSCKTKWKIRKC 156 ++E Y CH G +EKI L PSS FG +W+ + C Sbjct: 16 LSEPGNAYKQCHKKGGHCFPKEKICLPPSS--DFGKMDCRWRWKCC 59
>DPH1_YEAST (P40487) Diphthamide biosynthesis protein 1| Length = 425 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 76 IREKINLLPSS*NKFGSCKTKWKIRKCNSIRM 171 + E I LLPS+ N F KT W IRK N+ R+ Sbjct: 65 LNEAIKLLPSNYN-FEIHKTVWNIRKYNAKRI 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,111,764 Number of Sequences: 219361 Number of extensions: 676254 Number of successful extensions: 1063 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1063 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)