Clone Name | rbastl16g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AMPM_BUCAP (Q8K9T1) Methionine aminopeptidase (EC 3.4.11.18) (MA... | 28 | 4.8 | 2 | GATE_SULSO (Q97ZH6) Glutamyl-tRNA(Gln) amidotransferase subunit ... | 28 | 6.3 |
---|
>AMPM_BUCAP (Q8K9T1) Methionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase| M) Length = 261 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 115 QEKKNICHNFITSS*YISTLVVFFGFSK 198 +E NICHNFI +S + + GF K Sbjct: 39 EEINNICHNFIIKKKAVSACLGYHGFPK 66
>GATE_SULSO (Q97ZH6) Glutamyl-tRNA(Gln) amidotransferase subunit E (EC 6.3.5.-)| (Glu-ADT subunit E) Length = 633 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 134 HMFFFSCSTLLHQPLKMTL*VRWLQSS*WRTGRMAMIFLFRFKK 3 H F +CST L + K+TL R+L+ + G + + LF +KK Sbjct: 25 HKLFCNCSTNLEEEYKLTL-ERYLRPALSELGEVDVAALFEWKK 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,271,581 Number of Sequences: 219361 Number of extensions: 540712 Number of successful extensions: 1545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1545 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)