Clone Name | rbastl16f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAD13_CHICK (P33150) Cadherin-13 precursor (Truncated-cadherin) ... | 28 | 5.0 | 2 | BI54_MOUSE (P28664) Brain protein I54 | 28 | 8.6 |
---|
>CAD13_CHICK (P33150) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin)| (T-cad) Length = 712 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 37 GYYRKKNYIDNTIEQTQQQPIVHLVYNIYQG 129 G+ +K YI+ E T+ QPI++LV++ +G Sbjct: 30 GFQQKVFYIEQPFEFTEDQPILNLVFDDCKG 60
>BI54_MOUSE (P28664) Brain protein I54| Length = 130 Score = 27.7 bits (60), Expect = 8.6 Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = -1 Query: 145 WFIRAGLGKCCTLNVLSV--------VVEFVRLYCQYSFFSCNILAPQRQFKGIY 5 WF+ + LG+ C L L ++EF + FF AP+ G + Sbjct: 15 WFVGSALGRSCPLGFLGFHQPSLSLDILEFCGKFFSLEFFQLTACAPKEGVSGTH 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,902,936 Number of Sequences: 219361 Number of extensions: 522129 Number of successful extensions: 1485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)