Clone Name | rbastl16f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1629_HAEIN (P45280) Hypothetical protein HI1629 | 33 | 0.15 | 2 | MICA2_HUMAN (O94851) Protein MICAL-2 | 28 | 6.2 | 3 | RNZ_PORGI (Q51834) Ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNa... | 28 | 6.2 | 4 | PVRL2_HUMAN (Q92692) Poliovirus receptor-related protein 2 precu... | 28 | 8.1 | 5 | KINH_LOLPE (P21613) Kinesin heavy chain | 28 | 8.1 |
---|
>Y1629_HAEIN (P45280) Hypothetical protein HI1629| Length = 212 Score = 33.5 bits (75), Expect = 0.15 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -3 Query: 225 FSQFGCTGLFFFRQMHGLPSMPFSLV*GDVRRVTVCRYGWVDFCSGSCTI 76 FSQ+G LF R + GL + P +V G RRV+ R+ +DFC+ ++ Sbjct: 119 FSQYGNRVLFVARFLPGLRA-PIYMVSGITRRVSYVRFVLIDFCAAIISV 167
>MICA2_HUMAN (O94851) Protein MICAL-2| Length = 1124 Score = 28.1 bits (61), Expect = 6.2 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = +2 Query: 41 SKEYNNNVSVSTIVHEPLQK----STHPYLQTVTRRTSPHTKENGIEGKPCICRKKNKPV 208 SKE N V ++ ++ L K + +P L RR S GI GKP +C PV Sbjct: 706 SKEGGNQNKVKSMANQLLAKFEESTRNPSLMKQERRVS------GI-GKPVLCSSSGPPV 758 Query: 209 QPNCEKDYSQT 241 C K T Sbjct: 759 HSCCPKPEEAT 769
>RNZ_PORGI (Q51834) Ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNase Z) (tRNA 3| endonuclease) Length = 304 Score = 28.1 bits (61), Expect = 6.2 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 3 PHTHFHLSSKTISVKNTTIMYLCPQ*YMSHCKNQPIHICKQLHV 134 P TH H SS+ I +++ M C + +++ +H + +H+ Sbjct: 16 PTTHHHPSSQVIDLRDKLYMIDCGEGVQRQFRHEKLHFGRLIHI 59
>PVRL2_HUMAN (Q92692) Poliovirus receptor-related protein 2 precursor (Herpes| virus entry mediator B) (HveB) (Nectin-2) (CD112 antigen) Length = 538 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 97 KINPSISANSYTSDVSSYQGK 159 KINP A SY+S SYQGK Sbjct: 508 KINPIYDALSYSSPSDSYQGK 528
>KINH_LOLPE (P21613) Kinesin heavy chain| Length = 967 Score = 27.7 bits (60), Expect = 8.1 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +2 Query: 14 FSFVIKNNISKEYNNNVSVSTIVHEPL---QKSTHPYLQTVTRRTSPHTKENGIEGKP 178 F V+K N+S+EY NV IV + L + Y QT + +T HT E G+ KP Sbjct: 48 FDKVLKPNVSQEYVYNVGAKPIVADVLSGCNGTIFAYGQTSSGKT--HTME-GVLDKP 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,221,628 Number of Sequences: 219361 Number of extensions: 757265 Number of successful extensions: 2185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2185 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)