Clone Name | rbastl16f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y4UB_RHISN (Q53196) Probable aminotransferase y4uB (EC 2.6.1.-) | 28 | 5.2 | 2 | SYV_BUCAP (Q8K9I1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 28 | 5.2 | 3 | NUDT7_ARATH (Q9SU14) Nudix hydrolase 7 (EC 3.6.1.-) (AtNUDT7) (A... | 28 | 6.8 |
---|
>Y4UB_RHISN (Q53196) Probable aminotransferase y4uB (EC 2.6.1.-)| Length = 467 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 8 HNNA*GLPKKKKTTEGRREHHTIDFIIGQNKGF-FLHTTMH*PVP 139 +NN G P KKK R +H + G G F H M P+P Sbjct: 135 YNNLRGKPTKKKIISRERGYHGCSVVSGSMTGMSFYHDHMDLPLP 179
>SYV_BUCAP (Q8K9I1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 960 Score = 28.5 bits (62), Expect = 5.2 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 40 KNNGGPEGTSHHRLHYWAKQGIFSAHNN 123 K N P+ H ++W K G F +NN Sbjct: 2 KKNYNPKDIEEHLYNFWEKNGFFKPNNN 29
>NUDT7_ARATH (Q9SU14) Nudix hydrolase 7 (EC 3.6.1.-) (AtNUDT7) (ADP-ribose| pyrophosphatase) (EC 3.6.1.13) (NADH pyrophosphatase) (EC 3.6.1.22) Length = 282 Score = 28.1 bits (61), Expect = 6.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 15 MPEVCQKKKKQRRAGGNITPSTSLLGKTRDFFC 113 M +CQKK ++ G I P+T+ GK +C Sbjct: 231 MANICQKKCEEEYLGFAIVPTTTSSGKESFIYC 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,844,118 Number of Sequences: 219361 Number of extensions: 483277 Number of successful extensions: 1401 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1401 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)