| Clone Name | rbastl16f04 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 34.3 bits (77), Expect = 0.078 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -3 Query: 307 CLPKTCHPTGTAGSRRLMNL*Y-----GLVGDACDIASHSRKRERCGN*G 173 CL + CHP+GTA L N Y G G C++ + + C N G Sbjct: 1006 CLDRPCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGG 1055
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 31.2 bits (69), Expect = 0.66 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = -3 Query: 307 CLPKTCHPTGTAGSRRLMNL*Y-----GLVGDACDI 215 CL + CHPTGTA L N Y G G C++ Sbjct: 1010 CLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEV 1045
>PGCB_RAT (P55068) Brevican core protein precursor (Brain-enriched| hyaluronan-binding protein) (BEHAB protein) [Contains: Brevican core protein isoform 1; Brevican core protein isoform 2] Length = 883 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = -3 Query: 325 APARTHCLPKTCHPTGTA-----GSRRLMNL*YGLVGDACDIASH 206 AP+ C+P CH GT G R L YG GD CD+ H Sbjct: 620 APSSGDCIPSPCHNGGTCLEEKEGFRCLCVPGYG--GDLCDVGLH 662
>PGCB_MOUSE (Q61361) Brevican core protein precursor| Length = 883 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = -3 Query: 325 APARTHCLPKTCHPTGTA-----GSRRLMNL*YGLVGDACDIASH 206 AP+ C+P CH GT G R L YG GD CD+ H Sbjct: 620 APSSGDCIPSPCHNGGTCLEEKEGFRCLCLPGYG--GDLCDVGLH 662
>PGCB_BOVIN (Q28062) Brevican core protein precursor| Length = 912 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = -3 Query: 325 APARTHCLPKTCHPTGTA-----GSRRLMNL*YGLVGDACDIASH 206 AP+ C+P CH GT G R L YG GD CD+ H Sbjct: 645 APSSGDCVPSPCHNGGTCLEEEEGVRCLCLPGYG--GDLCDVGLH 687
>DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 354 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 71 SLNFSTYDVSWSLMDDKIYISTEVYAYRLNMVSP 172 S N STYD W ++++K+Y E RL SP Sbjct: 254 SQNISTYDECWQVIEEKLYPELE---KRLERASP 284
>PIG1_YEAST (Q06216) Serine/threonine-protein phosphatase 1 regulatory subunit| PIG1 Length = 648 Score = 28.1 bits (61), Expect = 5.6 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = +2 Query: 44 TKQNWPTVLSLNFSTYDVSWSLMDDKIYISTEVYAYRLNMVSPALVTTSFSFARVTSNIT 223 T NW + +N + Y+ S + D+ ++ A +LN++S L+ T+F F R T T Sbjct: 244 TLNNWADIHYIN-AHYNKSVTPHVDEFKFIIDISALKLNLISKNLIYTNF-FERKT---T 298 Query: 224 CISN 235 C+ N Sbjct: 299 CLLN 302
>BGAL_BACST (P19668) Beta-galactosidase 1 (EC 3.2.1.23) (Beta-galactosidase I)| (Lactase) Length = 672 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 29 KAQNLTKQNWPTVLSLNFSTYDVSWSLMDDKIY 127 + Q W ++ +N + Y+V+ SL +DKIY Sbjct: 607 EVQQRETDEWKYLIIINHNDYEVTLSLPEDKIY 639
>PGCB_HUMAN (Q96GW7) Brevican core protein precursor (Brain-enriched| hyaluronan-binding protein) (BEHAB protein) Length = 911 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = -3 Query: 322 PARTHCLPKTCHPTGTA-----GSRRLMNL*YGLVGDACDI 215 PA C+P CH GT G R L YG GD CD+ Sbjct: 645 PASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYG--GDLCDV 683
>PAN2_YEAST (P53010) PAB-dependent poly(A)-specific ribonuclease subunit PAN2| (EC 3.1.13.4) (PAB1P-dependent poly(A)-nuclease) Length = 1115 Score = 27.3 bits (59), Expect = 9.5 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 35 QNLTKQNWPTVLSLNFSTYDVSWS-LMDDKIYISTEVYAYRLNMVSPALVTTSFSFARVT 211 Q T +N P+VLSL S D +S + K ++++E Y + + A++ ++ S + T Sbjct: 724 QECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIK--NKAVLRSTASELKGT 781 Query: 212 SNI 220 S+I Sbjct: 782 SHI 784 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,977,320 Number of Sequences: 219361 Number of extensions: 831136 Number of successful extensions: 1763 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1763 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)