Clone Name | rbastl16e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CATR_NAEGR (P53441) Caltractin (Centrin) | 28 | 5.7 | 2 | YA7B_SCHPO (Q09764) Hypothetical protein C24H6.11c in chromosome I | 28 | 5.7 | 3 | HISX_PELCD (Q3A133) Histidinol dehydrogenase (EC 1.1.1.23) (HDH) | 28 | 7.4 | 4 | NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding pr... | 27 | 9.7 | 5 | NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding pr... | 27 | 9.7 |
---|
>CATR_NAEGR (P53441) Caltractin (Centrin)| Length = 172 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 331 KPSEHNSELEVMEAQTL--DDDSGYETFGN 248 K SE +S E+M+A L +DDSG+ TF N Sbjct: 96 KMSEKDSHAEIMKAFRLFDEDDSGFITFAN 125
>YA7B_SCHPO (Q09764) Hypothetical protein C24H6.11c in chromosome I| Length = 958 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -3 Query: 316 NSELEVMEAQTLDDDSGYETFGNGSEVLELKDSAGTPKSIAVEGRHEHDV 167 NS LE E LDD Y T +L AG ++AV G+H+ ++ Sbjct: 727 NSSLEYCENMLLDDYDVYRT--------KLLHKAGYSHTLAVPGKHKQNI 768
>HISX_PELCD (Q3A133) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -3 Query: 244 SEVLELKDSAGTPKSIAVE--GRHEHD 170 SE+L + D +GTP+ IAV+ + EHD Sbjct: 237 SEILVINDGSGTPEHIAVDLLSQAEHD 263
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = +1 Query: 241 QNHCQMSHNQNHH-------PEFGPP*PPVQSCARMASA 336 QNH H+Q+HH + PP PP+ + + AS+ Sbjct: 12 QNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASS 50
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = +1 Query: 241 QNHCQMSHNQNHH-------PEFGPP*PPVQSCARMASA 336 QNH H+Q+HH + PP PP+ + + AS+ Sbjct: 12 QNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASS 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,470,790 Number of Sequences: 219361 Number of extensions: 710415 Number of successful extensions: 2015 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2011 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)