| Clone Name | rbastl16e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC... | 30 | 2.1 | 2 | MT2_CANGA (P15114) Metallothionein-2 (MT-2) (Metallothionein-II)... | 29 | 3.6 | 3 | FIXC_RHISN (Q53208) Protein fixC | 28 | 4.7 | 4 | FIXC_RHIME (P09820) Protein fixC | 28 | 8.0 |
|---|
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 123 YSCCGVPLYICCNSITEWCCTRAVSCLTCFY 31 + CC +P +CC S + CC + +CL Y Sbjct: 384 WGCCPIPEAVCC-SDNQHCCPQGFTCLAQGY 413 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 123 YSCCGVPLYICCNSITEWCCTRAV------SCLTCFYLIDDITSFP 4 Y CC +P ICC+ C V CL+ Y D +T P Sbjct: 228 YGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLP 273
>MT2_CANGA (P15114) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| [Contains: Metallothionein-2' (MT-2') (Metallothionein-II') (MT-II')] Length = 51 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 120 SCCGVPLYICCNSITEWCCTRAVSCLTC 37 +CC P C NS + C + C TC Sbjct: 22 NCCAKPACACTNSASNECSCQTCKCQTC 49
>FIXC_RHISN (Q53208) Protein fixC| Length = 435 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 140 QNFINSSATPKIEKPILT*AALV*SR 217 QNF+ TPKIEK T AAL+ +R Sbjct: 393 QNFVRVDGTPKIEKERATTAALIKAR 418
>FIXC_RHIME (P09820) Protein fixC| Length = 435 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 140 QNFINSSATPKIEKPILT*AALV*SR 217 QNF+ TPKIE+ I T AA + +R Sbjct: 393 QNFVRVDGTPKIEREIATTAAFLRAR 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.121 0.341 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,103,273 Number of Sequences: 219361 Number of extensions: 470462 Number of successful extensions: 1157 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1157 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)