Clone Name | rbastl16e05 |
---|---|
Clone Library Name | barley_pub |
>XIST_MOUSE (P27571) X inactive-specific transcript protein (Fragment)| Length = 298 Score = 32.0 bits (71), Expect = 0.41 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -1 Query: 262 VCLDIANSIWSVLLCC-NKFIPQRLVGVHCLPEASVPSFFAGVCIFC*PCSVPFVLFMLH 86 VCL + ++ +L C N + L CL + VC+FC C +P +F+LH Sbjct: 59 VCLCLPCFVYLLLPCVSNSLLHLFLPSFACL-------LLSFVCLFCLQCVLPIPMFLLH 111 Query: 85 ALAVISCEGM 56 V+SC + Sbjct: 112 ---VLSCRAL 118
>ODPA_SCHPO (Q10489) Pyruvate dehydrogenase E1 component alpha subunit,| mitochondrial precursor (EC 1.2.4.1) (PDHE1-A) Length = 409 Score = 30.8 bits (68), Expect = 0.91 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +1 Query: 97 TTRTVQSKVNKKYIPPQKKTVQRPLEGNGHQPIFEG*ICYSIEVPTKCCWRCRGKLIGMV 276 TT S+ N ++P + +P +FEG Y I+VP+ +G+L+G+ Sbjct: 29 TTDATTSRANPAHVPEEH---DKPFPVKLDDSVFEG---YKIDVPSTEIEVTKGELLGLY 82 Query: 277 ESMIQL 294 E M+ + Sbjct: 83 EKMVTI 88
>AKAP3_HUMAN (O75969) A-kinase anchor protein 3 (Protein kinase A-anchoring| protein 3) (PRKA3) (A-kinase anchor protein 110 kDa) (AKAP 110) (Sperm oocyte-binding protein) (Fibrousheathin I) (Fibrous sheath protein of 95 kDa) (FSP95) Length = 853 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = +2 Query: 116 ARSTKNTYPRKKRRYRGLWKAMDTNQSLRDKFVTA*KYRPNAVGDVEANLLEWLKV 283 AR +PR+++R+RG + D S+ + +T Y + V D+ ++++ LK+ Sbjct: 254 AREGGRFFPRERKRFRGQERPDDFTASVSEGIMT---YANSVVSDMMVSIMKTLKI 306
>NU2M_PARTE (P15577) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 193 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/64 (29%), Positives = 36/64 (56%) Frame = -2 Query: 240 AFGRYFYAVTNLSLKDWLVSIAFQRPLYRLFLRGYVFFVDLALYRSCCLCYML*Q*FHVK 61 +FG+YFY+ + L+L ++++ F + G +FF++LALY + F+VK Sbjct: 13 SFGKYFYSTSFLNL--LMINLMFSK-------LGAIFFLNLALYLLALALFFFFL-FNVK 62 Query: 60 VCIV 49 V ++ Sbjct: 63 VALL 66
>VG6_SPV1R (P15897) Gene 6 protein| Length = 113 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = -2 Query: 162 LYRLFLRGYVFFVDLALYRSCCLCYML*Q*FHVKVCIVCTEHHL*LILSKTFLF 1 + R F G+ +F+ L + C +C+++ F V++ +V L LILS LF Sbjct: 19 IIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFPFLLLILSVWNLF 72
>YJ8J_SCHPO (Q8J1M7) Hypothetical protein C330.19c in chromosome III| Length = 90 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 164 LCTVFFCGGMYFLLTLLCTVRVVYVTCFSSNF 69 L FFC +YFL T L + TC +S F Sbjct: 41 LLFAFFCPCIYFLHTFLADCEIAKSTCITSVF 72
>AXUD1_MOUSE (P59054) Axin-1 up-regulated gene 1 protein (TGF-beta-induced| apoptosis protein 3) (TAIP-3) Length = 583 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 299 QCNCIILSTIPISL----PRHRQQHLVGTSML*QIYPSKIGWCPLPSRGLCTV 153 Q +C + S P S+ PR R H+ + +P G+ +PSRG CT+ Sbjct: 59 QDSCGLQSFTPPSILKRAPRERPGHVAFNGITVYYFPRCQGFTSVPSRGGCTL 111
>MBD5_HUMAN (Q9P267) Methyl-CpG-binding domain protein 5 (Methyl-CpG-binding| protein MBD5) Length = 1494 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -3 Query: 293 NCIILSTIPISLPRHRQQHLVGTSML*QIYPS 198 N +LS++PISLP + QQHL+ ++L + PS Sbjct: 915 NPSLLSSLPISLPVN-QQHLLNQNLLNILQPS 945 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,103,018 Number of Sequences: 219361 Number of extensions: 991530 Number of successful extensions: 2750 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2750 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)