Clone Name | rbastl16d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 p... | 29 | 2.5 | 2 | SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 2.5 | 3 | LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 p... | 28 | 5.5 | 4 | K1718_HUMAN (Q6ZMT4) Protein KIAA1718 | 28 | 7.2 | 5 | K1718_MOUSE (Q3UWM4) Protein KIAA1718 | 28 | 7.2 | 6 | Y2077_ARCFU (O28202) Hypothetical protein AF2077 precursor | 28 | 7.2 |
---|
>LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 protein)| Length = 350 Score = 29.3 bits (64), Expect = 2.5 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -1 Query: 316 DGGEVQLGVGEQRSPWEAHGGERHQLQGLAVRLACCGFFSKMFVYGWL----FPVSKL 155 D +VQL + ++A GG H+L GL L C F F + W FP+ L Sbjct: 210 DVSDVQLEFTKLNIYFKARGGAYHRLHGLVANLGCLSF---CFCWFWFRLYWFPLKVL 264
>SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 882 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 260 VSFPWRTLLSDAELYFSSVDDATTKPEPTF 349 V FP + LSDA L S ++ ATT+PE F Sbjct: 204 VDFPTNSNLSDASLVPSFLEIATTRPETMF 233
>LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1| protein) Length = 350 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -1 Query: 316 DGGEVQLGVGEQRSPWEAHGGERHQLQGLAVRLACCGF-FSKMFVYGWLFPVSKL 155 D +VQL + +++ GG H+L LA L C F FS + + FP+ L Sbjct: 210 DISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVL 264
>K1718_HUMAN (Q6ZMT4) Protein KIAA1718| Length = 941 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 219 LHAVVSSQKCLCMGGCFLY 163 +HAV++SQ C+ GG FL+ Sbjct: 353 IHAVLTSQDCMAFGGNFLH 371
>K1718_MOUSE (Q3UWM4) Protein KIAA1718| Length = 940 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 219 LHAVVSSQKCLCMGGCFLY 163 +HAV++SQ C+ GG FL+ Sbjct: 353 IHAVLTSQDCMAFGGNFLH 371
>Y2077_ARCFU (O28202) Hypothetical protein AF2077 precursor| Length = 270 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 290 DAELYFSSVDDATTKPEPTFQY 355 D ELYFS+ +D T PTF Y Sbjct: 72 DVELYFSTPNDILTFSNPTFLY 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,085,026 Number of Sequences: 219361 Number of extensions: 784748 Number of successful extensions: 2085 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2084 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)