ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl16d01 |
|---|---|
| Clone Library Name | barley_pub |
>VGLY_MOPEI (P19240) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 489 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 31 IYSYPTPQAFKFYTSTNIRDDATKVLSVTTRLAQVHPLPINKTSGNFFPGESCLQNSALV 210 ++S P+P F ++ T+ ++ RL + ++ + GN PG CL S L+ Sbjct: 230 MFSRPSPMGF-----LSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLI 284 Query: 211 G 213 G Sbjct: 285 G 285
>HMP_RHIME (Q7WUM8) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 403 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 232 VPEAGGDQQVRYSVNSSPLGKSYRMS 155 VP+ G Q +YS++ SP G+SYR+S Sbjct: 197 VPKLGYQQIRQYSLSDSPNGRSYRIS 222
>FGRL1_MOUSE (Q91V87) Fibroblast growth factor receptor-like 1 precursor (FGF| receptor-like protein 1) (Fibroblast growth factor receptor 5) Length = 529 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 11/74 (14%) Frame = -2 Query: 340 CKAXXXXXXXXXXXXXXXGDPQAQGEAREGPGGKRGVPEAGGDQQ-----------VRYS 194 CKA D + G+ GPGG G E QQ +R Sbjct: 95 CKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQPSKMRRR 154 Query: 193 VNSSPLGKSYRMSC 152 V + P+G S R+ C Sbjct: 155 VIARPVGSSVRLKC 168
>KLF13_MOUSE (Q9JJZ6) Krueppel-like factor 13 (Transcription factor BTEB3)| (Basic transcription element-binding protein 3) (BTE-binding protein 3) (RANTES factor of late activated T-lymphocytes 1) (RFLAT-1) (Erythroid transcription factor FKLF-2) Length = 289 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 207 CWSPPASGTPRFPPGPSRASP*ACGSP 287 C PPA P PPGP ASP G+P Sbjct: 95 CRLPPAPPAP--PPGPEPASPGQAGAP 119
>FGRL1_RAT (Q7TQM3) Fibroblast growth factor receptor-like 1 precursor (FGF| receptor-like protein 1) Length = 529 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 11/74 (14%) Frame = -2 Query: 340 CKAXXXXXXXXXXXXXXXGDPQAQGEAREGPGGKRGVPEAGGDQQ-----------VRYS 194 CKA D + G+ GPGG G E QQ +R Sbjct: 95 CKATNGFGSLSVNYTLIIMDDISPGKENPGPGGSSGGQEDPVSQQWARPRFTQPSKMRRR 154 Query: 193 VNSSPLGKSYRMSC 152 V + P+G S R+ C Sbjct: 155 VIARPVGSSVRLKC 168
>CXSO6_CONST (Q9XZK5) Delta-conotoxin SVIE precursor (Delta-SVIE) (Conotoxin| SO6) (Conotoxin 4) Length = 82 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 292 GFHPGLCRHPLCF*PCILF 348 G HPGLC CF CI F Sbjct: 62 GIHPGLCCSEFCFLWCITF 80
>CXO9_CONST (Q5K0D2) Conotoxin-9 precursor| Length = 82 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 292 GFHPGLCRHPLCF*PCILF 348 G HPGLC CF CI F Sbjct: 62 GIHPGLCCSEFCFLWCITF 80
>C79A1_SORBI (Q43135) Cytochrome P450 79A1 (EC 1.14.13.41) (Tyrosine| N-monooxygenase) (Cytochrome P450Tyr) Length = 557 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +3 Query: 204 TCWSPPAS-GTPRFPPGP 254 TC SPPA G P PPGP Sbjct: 54 TCASPPAGVGNPPLPPGP 71
>KLF12_MOUSE (O35738) Krueppel-like factor 12 (Transcriptional repressor| AP-2rep) Length = 402 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +1 Query: 70 TSTNIRDDATKVLSVTTRLAQVHPLPINKTSGN 168 T ++ + + LS+ + +VHP P+++ GN Sbjct: 249 TLDSVNETGSTALSIARAVQEVHPSPVSRVRGN 281
>KLF12_HUMAN (Q9Y4X4) Krueppel-like factor 12 (Transcriptional repressor| AP-2rep) Length = 402 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +1 Query: 70 TSTNIRDDATKVLSVTTRLAQVHPLPINKTSGN 168 T ++ + + LS+ + +VHP P+++ GN Sbjct: 249 TLDSVNETGSTALSIARAVQEVHPSPVSRVRGN 281
>CU058_HUMAN (P58505) Protein C21orf58| Length = 239 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 28 LIYSYPTPQAFKFYTSTNIRDDATKVLSVTTRLAQVHPL 144 LI P PQAF S +I++D ++L + AQVH L Sbjct: 137 LIAQIPPPQAFPTQRSGSIKEDMVELLLLQN--AQVHQL 173
>CD5R2_HUMAN (Q13319) Cyclin-dependent kinase 5 activator 2 precursor (CDK5| activator 2) (Cyclin-dependent kinase 5 regulatory subunit 2) (P39) (P39I) Length = 367 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +3 Query: 216 PPASG----TPRFPPGPSRASP*ACGSPRRI 296 PP SG P PP P A P GSPRR+ Sbjct: 147 PPGSGGGKPPPPPPPAPQVAPPVPGGSPRRV 177
>FOG1_HUMAN (Q8IX07) Zinc finger protein ZFPM1 (Zinc finger protein multitype| 1) (Friend of GATA protein 1) (Friend of GATA-1) (FOG-1) Length = 1004 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 219 PASGTPRFPPGPSRASP 269 PA+ P+ PPGP+RA P Sbjct: 608 PAARRPKAPPGPARAPP 624
>M3K11_HUMAN (Q16584) Mitogen-activated protein kinase kinase kinase 11 (EC| 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase) Length = 847 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 219 PASGTPRFPPGPSRASP*ACGSPR 290 P GT PPG SR++P G+PR Sbjct: 734 PRGGTVSPPPGTSRSAPGTPGTPR 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,457,653 Number of Sequences: 219361 Number of extensions: 796491 Number of successful extensions: 2579 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2576 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
