Clone Name | rbastl16c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYR_WIGBR (Q8D372) Arginyl-tRNA synthetase (EC 6.1.1.19) (Argini... | 28 | 4.4 | 2 | AT11B_HUMAN (Q9Y2G3) Probable phospholipid-transporting ATPase I... | 27 | 9.7 | 3 | SYR_BUCBP (P59483) Arginyl-tRNA synthetase (EC 6.1.1.19) (Argini... | 27 | 9.7 | 4 | AT11B_RABIT (Q9N0Z4) Probable phospholipid-transporting ATPase I... | 27 | 9.7 |
---|
>SYR_WIGBR (Q8D372) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 576 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +1 Query: 103 KLVPPCVLGLYLSTYSTALHSFYNKCCPSKRKNERPKNTYMILQL 237 KL P +L YL S FY C K K E KN+ + L + Sbjct: 511 KLGTPHILCNYLYDLSKTFSVFYENCSIIKTKEESVKNSRLFLSI 555
>AT11B_HUMAN (Q9Y2G3) Probable phospholipid-transporting ATPase IF (EC 3.6.3.1)| (ATPase class I type 11B) (ATPase IR) Length = 1177 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -3 Query: 253 RQMHCAAVESCMCFSAFHSFFCLDNICCKMNVMLYCKSIGR 131 R +H + E CLD++CC C S+GR Sbjct: 1095 RHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGR 1135
>SYR_BUCBP (P59483) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 578 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 115 PCVLGLYLSTYSTALHSFYNKCCPSKRKNERPKNTYMILQLHNA 246 P ++ YL S FY KC K KN + + ++L L A Sbjct: 517 PHIICKYLYELSKIFSKFYEKCSIYKSKNTKIRKNRLLLSLLTA 560
>AT11B_RABIT (Q9N0Z4) Probable phospholipid-transporting ATPase IF (EC 3.6.3.1)| (ATPase class I type 11B) (ATPase IR) (RING-finger-binding protein) (Fragment) Length = 1169 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 253 RQMHCAAVESCMCFSAFHSFFCLDNICCKMNVMLYCKSIGR 131 RQ+H + E S C+D++CC C S+ R Sbjct: 1087 RQLHPTSTEKAQLTETNSSIKCVDSLCCFPEGETTCTSVRR 1127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,294,786 Number of Sequences: 219361 Number of extensions: 852551 Number of successful extensions: 2073 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2073 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)