Clone Name | rbastl16b10 |
---|---|
Clone Library Name | barley_pub |
>TPMT_VIBF1 (Q5E4N9) Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine| methyltransferase) Length = 213 Score = 31.6 bits (70), Expect = 0.48 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = -2 Query: 190 NFYGFHTPLAKMYEDQRQPLANGRRNKTLFVPVFVLCGSHRRNV*LIHLDMIGKRHN 20 N GFH P Q +RN+T+FVP LCG + LD + +RHN Sbjct: 13 NVIGFHLPDTNPILTQYWSALEPKRNETVFVP---LCGKS------MDLDWLAERHN 60
>PPCK_WIGBR (Q8D1X9) Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 541 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 214 NCCWWITQNFY--GFHTPLAKMYEDQRQPLANGRRNKTLFVPVFVLCGSHRRN 62 N WW N + H + ++D ++ +AN NK LFV + CG++++N Sbjct: 79 NIIWWSDDNNHKSNNHPINNETWKDLKKLIANNLNNKKLFV-IDAFCGANKKN 130
>RASA2_HUMAN (Q15283) Ras GTPase-activating protein 2 (GAP1m)| Length = 849 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 22 CDVFLSCQDGSVIHFGDESHTRQKQGQKASCFFCHLLVAVVDPHTF 159 CD+F S + + F ++ H Q + F VAVV PHTF Sbjct: 479 CDIFYSLRQMATQRFPNDPHV-QYSAVSSFVFLRFFAVAVVSPHTF 523
>SWF1_ASHGO (Q74ZZ2) Palmitoyltransferase SWF1 (EC 2.3.1.-)| Length = 326 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +1 Query: 46 DGSVIHFGDESHTRQ--KQGQKASCFFCHLLVAVVDPHTFWRAACEIRRNFG 195 DG + H G E T + K + C C V + D H W C R N+G Sbjct: 116 DGLLFHDGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYG 167
>ATG26_YARLI (Q6C8M8) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1424 Score = 28.9 bits (63), Expect = 3.1 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +3 Query: 204 QQQLNPPPRSLVQRPNHDAN*TFQSETSLG--RRRRALIDLLRTSKWMGLLFPFP 362 +++L PPPR L+Q P H + QS T+ R R + L R + + LL P Sbjct: 40 RRRLQPPPRLLIQAPIHPSRHCTQSRTAHRSIRSPRRCLTLCRLTLSVTLLLTKP 94
>MTH14_DROME (Q8SYV9) Probable G-protein coupled receptor Mth-like 14 precursor| (Protein methuselah-like 14) Length = 533 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = +1 Query: 4 LMYTNNCDVFLSCQDGSVI---HFGDESHT 84 L+Y + DVF QDGS++ FG+ES+T Sbjct: 181 LLYDDKDDVFFVLQDGSLLIIDKFGNESYT 210
>MDR1_CAEEL (P34712) Multidrug resistance protein 1 (EC 3.6.3.44)| (P-glycoprotein A) Length = 1321 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 19 NCDVFLSCQDGSVIHFGDESHTRQKQG 99 N D+ +SC++G V+ GD +QG Sbjct: 618 NADLIISCKNGQVVEVGDHRALMAQQG 644
>MURC_BIFLO (Q8G4Q4) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 512 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 28 VFLSCQDGSVIHFGDESHTRQKQGQKASCFFCHLLVAVVDP 150 + +C+ + H+GDE+H R A H+++++ DP Sbjct: 201 IITNCEADHLDHYGDEAHYRAAFVAHAGRATGHVIISIDDP 241
>ATF2_HUMAN (P15336) Cyclic AMP-dependent transcription factor ATF-2| (Activating transcription factor 2) (cAMP response element-binding protein CRE-BP1) (HB16) Length = 487 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 207 QQLNPPPRSLVQRPNHDAN*TFQSETSLGRRRRA 308 Q L P S + P A+ T Q++++ GRRRRA Sbjct: 295 QSLQQPATSTTETPASPAHTTPQTQSTSGRRRRA 328
>ATF2_RAT (Q00969) Cyclic AMP-dependent transcription factor ATF-2| (Activating transcription factor 2) (cAMP response element-binding protein CRE-BP1) Length = 487 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 207 QQLNPPPRSLVQRPNHDAN*TFQSETSLGRRRRA 308 Q L P S + P A+ T Q++ + GRRRRA Sbjct: 295 QSLQQPATSTTETPASPAHTTPQTQNTSGRRRRA 328
>ATF2_MOUSE (P16951) Cyclic AMP-dependent transcription factor ATF-2| (Activating transcription factor 2) (cAMP response element-binding protein CRE-BP1) (MXBP protein) Length = 487 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 207 QQLNPPPRSLVQRPNHDAN*TFQSETSLGRRRRA 308 Q L P S + P A+ T Q++ + GRRRRA Sbjct: 295 QSLQQPATSTTETPASPAHTTPQTQNTSGRRRRA 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,172,819 Number of Sequences: 219361 Number of extensions: 1079701 Number of successful extensions: 2294 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2294 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)