Clone Name | rbastl16b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CATA_ASPFU (P78574) Catalase A (EC 1.11.1.6) (Fast catalase) | 28 | 4.9 | 2 | CATA_EMENI (P55305) Catalase A (EC 1.11.1.6) (Spore-specific cat... | 28 | 4.9 |
---|
>CATA_ASPFU (P78574) Catalase A (EC 1.11.1.6) (Fast catalase)| Length = 750 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 211 PLGFDLMQVFGVPQHGMLGGKGCRHGGSFTMLLHLGI 101 P + +MQ FGV ++ +G RH F + HLG+ Sbjct: 228 PRSYRMMQGFGVNTFALVNKEGKRHFVKFHWIPHLGV 264
>CATA_EMENI (P55305) Catalase A (EC 1.11.1.6) (Spore-specific catalase)| Length = 744 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 211 PLGFDLMQVFGVPQHGMLGGKGCRHGGSFTMLLHLGI 101 P + +MQ FGV ++ +G RH F + HLG+ Sbjct: 228 PRSYRMMQGFGVNTFSLVNKEGKRHFVKFHWIPHLGV 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,877,489 Number of Sequences: 219361 Number of extensions: 671803 Number of successful extensions: 1613 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1613 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)