>JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone demethylation|
           protein 2C (EC 1.14.11.-) (Jumonji domain-containing
           protein 1C)
          Length = 2350

 Score = 29.3 bits (64), Expect = 3.7
 Identities = 18/58 (31%), Positives = 24/58 (41%)
 Frame = +2

Query: 215 HLSR*QPCSNNLVLHGSTTPRA*GSHLFSSQTKSRAIAHVPIRQHPISSNRQHPASSP 388
           H S  + C N    H + TP   G HL +  T    +    I  HP++S   HP   P
Sbjct: 560 HSSSHRTCLNPGTHHPALTP---GPHLLAGSTSQTPLP--TINTHPLTSGPHHPVHHP 612


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,643,233
Number of Sequences: 219361
Number of extensions: 1211848
Number of successful extensions: 2265
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2231
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2259
length of database: 80,573,946
effective HSP length: 100
effective length of database: 58,637,846
effective search space used: 2169600302
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)