| Clone Name | rbastl16a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 ... | 33 | 0.34 | 2 | CHD9_MOUSE (Q8BYH8) Chromodomain-helicase-DNA-binding protein 9 ... | 31 | 0.99 | 3 | DAX1_RAT (P70503) Nuclear receptor 0B1 (Nuclear receptor DAX-1) | 28 | 6.4 | 4 | MSX2_HUMAN (P35548) Homeobox protein MSX-2 (Hox-8) | 28 | 8.3 |
|---|
>CHD9_HUMAN (Q3L8U1) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Chromatin-related mesenchymal modulator) (CReMM) (Chromatin remodeling factor CHROM1) (Peroxisomal proliferator-activated receptor A-inter Length = 2897 Score = 32.7 bits (73), Expect = 0.34 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 275 SSFSTCSHSGGEWLSCSSCVCALAGSAGAETTQGSSSNA 391 SS S+CSHS S SS C+ A S+ + +T SSS++ Sbjct: 2151 SSSSSCSHSRSGSSSSSSSSCSSASSSSSSSTSSSSSSS 2189
>CHD9_MOUSE (Q8BYH8) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein) (PPAR-alpha-interacting complex protein 320 kDa) Length = 2885 Score = 31.2 bits (69), Expect = 0.99 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +2 Query: 275 SSFSTCSHSGGEWLSCSSCVCALAGSAGAETTQGSSSNA 391 SS S+CSHS S SS C+ A S+ + ++ SSS++ Sbjct: 2151 SSSSSCSHSRSGSSSSSSSSCSSASSSSSSSSSSSSSSS 2189
>DAX1_RAT (P70503) Nuclear receptor 0B1 (Nuclear receptor DAX-1)| Length = 472 Score = 28.5 bits (62), Expect = 6.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 293 SHSGGEWLSCSSCVCALAGSAGAETTQ 373 +H GGEW S C + G G ++TQ Sbjct: 167 AHRGGEWWQLSYCTHNVGGPEGLQSTQ 193
>MSX2_HUMAN (P35548) Homeobox protein MSX-2 (Hox-8)| Length = 267 Score = 28.1 bits (61), Expect = 8.3 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 231 NQMPFTSNGFLGEKSPPSAHAPIPAVSGLAARHACARLQVPLVPRQHRALQA 386 + +PF+ + +K PP +P+PA S A A L+ PL+ H A +A Sbjct: 43 SSLPFSVEALMSDKKPPKEASPLPAESASAG----ATLR-PLLLSGHGAREA 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,977,401 Number of Sequences: 219361 Number of extensions: 1362900 Number of successful extensions: 3522 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3522 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)