Clone Name | rbastl16a01 |
---|---|
Clone Library Name | barley_pub |
>YCF80_GUITH (O78449) Hypothetical 33.2 kDa protein ycf80| Length = 282 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 68 EILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITG-SWELDSN 211 EI NSR+S KY+ FK I ++YS +T W L SN Sbjct: 216 EIKNILNVNSNSRVSFHPKQKYDKNWFKGIPIFIYSPTVTNLDWTLKSN 264
>CRY2_VIBCH (Q9KS67) Cryptochrome-like protein cry2| Length = 504 Score = 29.6 bits (65), Expect = 1.9 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = -1 Query: 327 SIAGFQRMLWAYSNRASF-CNF*LRSVHRRCE----DVNLAWSSLLSSSHD 190 S+AGF+R L A S+R + C+F ++ CE VN A+ SLL S D Sbjct: 253 SVAGFRRSLIALSSRLHWHCHF-IQKFESECEMEFRCVNRAYDSLLQQSSD 302
>SPA12_MOUSE (Q7TMF5) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 413 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 159 EITCTVL*LQGRGNLTATMTMPN 227 +++CT+L + RGN+TAT +P+ Sbjct: 254 QLSCTILEIPYRGNITATFVLPD 276
>SPA12_RAT (Q8R4Z1) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 411 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 159 EITCTVL*LQGRGNLTATMTMPN 227 +++CT+L + RGN+TAT +P+ Sbjct: 254 QLSCTILEMPYRGNITATFVLPD 276
>Y085_BUCBP (Q89AY5) Hypothetical UPF0011 protein bbp_085| Length = 292 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +2 Query: 44 KSLALVTTEILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITGSWELDSNDD 217 K+ L++ +L+T K + +S +K +G +KL +Y+Y++ I + + N+D Sbjct: 236 KNTNLISDAVLKTLKILK-THLSFNKAIKITAGIYKLPKNYLYNYAINNT--ISKNND 290
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 27.7 bits (60), Expect = 7.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 259 ELKVAKRCTIRVGPQHSLETSNRSVHCL 342 ++K AK + +GP + T+NR++ C+ Sbjct: 388 DVKTAKSMKVDIGPTRWIPTANRTIRCI 415
>SWI6_KLULA (P40418) Regulatory protein SWI6 (Cell-cycle box factor, chain| SWI6) (Trans-acting activator of HO endonuclease gene) (MBF subunit P90) Length = 769 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 110 SIRSFLKYNSGCFKLIGDYMYSFII 184 S++S Y+SG F+++ DY+Y I+ Sbjct: 327 SVKSVNNYDSGTFEILLDYLYPCIV 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,511,988 Number of Sequences: 219361 Number of extensions: 903935 Number of successful extensions: 1874 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1874 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)