Clone Name | rbastl15h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FPS_DROME (P18106) Tyrosine-protein kinase Fps85D (EC 2.7.10.2) ... | 31 | 1.3 | 2 | SEM6D_MOUSE (Q76KF0) Semaphorin-6D precursor | 28 | 6.6 | 3 | DESS_MYXXA (P02966) Development-specific protein S (Spore coat p... | 28 | 6.6 |
---|
>FPS_DROME (P18106) Tyrosine-protein kinase Fps85D (EC 2.7.10.2) (dFer)| Length = 1325 Score = 30.8 bits (68), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +3 Query: 198 RFMQLQPSESSTKSIMLLCSENLHHLCSYFP-TEHRSTQARNRHHLSHRLAPAHALPQE 371 RF +LQP S S+ ++ N Y P T HR QA + H+L +A + P + Sbjct: 477 RFNKLQPRSQSLGSLSVIRDGNGPSPARYEPITNHRLRQAASVHYLGEEIATSSTNPPD 535
>SEM6D_MOUSE (Q76KF0) Semaphorin-6D precursor| Length = 1073 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%) Frame = +2 Query: 203 HATATKRKFH*EY-------HAPLFREPAPFVLLLPNGTQEYTGAESSS 328 H+ RK H ++ H+PL P ++LPN T +Y + S+S Sbjct: 796 HSHGASRKEHPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTSFSNS 844
>DESS_MYXXA (P02966) Development-specific protein S (Spore coat protein S)| Length = 173 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 381 VKLTPGVRHVLVPNDGTGDDDSAPVYSCVPLGSRSTNGAGSR 256 VK+ PGV+ +L NDG D V + LG + N + R Sbjct: 42 VKVPPGVKAILYQNDGFAGDQIEVVANAEELGPLNNNVSSIR 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,434,987 Number of Sequences: 219361 Number of extensions: 1240681 Number of successful extensions: 3342 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3341 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)