Clone Name | rbastl15h06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IBP_BUCAI (P57640) Small heat shock protein ibp | 29 | 3.5 | 2 | UXAA_ECOLI (P42604) Altronate hydrolase (EC 4.2.1.7) (Altronic a... | 28 | 7.8 |
---|
>IBP_BUCAI (P57640) Small heat shock protein ibp| Length = 157 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 58 LNFSLNYKAKKKRNELD*RLLPASTKLGLPAVERP 162 LNF+L++K K K+ EL LL + +P E+P Sbjct: 106 LNFNLDHKIKVKKAELSLGLLKLDFECNIPEEEKP 140
>UXAA_ECOLI (P42604) Altronate hydrolase (EC 4.2.1.7) (Altronic acid hydratase)| Length = 495 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 107 TEGCYLHLPNWGCQQLSGHEVEPRTRNINFSMHLF*HAGNELTVGI 244 T+G +L +GC QL + RT N H +AG L +G+ Sbjct: 154 TDGVFLFSHTYGCSQLGDDHINTRTMLQNMVRHP--NAGAVLVIGL 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,404,679 Number of Sequences: 219361 Number of extensions: 508820 Number of successful extensions: 1144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1144 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)