Clone Name | rbastl15h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CPSY_MYCTU (O06628) Exopolysaccharide phosphotransferase cpsY (E... | 29 | 5.2 | 2 | CPSY_MYCBO (Q7U184) Exopolysaccharide phosphotransferase cpsY (E... | 29 | 5.2 |
---|
>CPSY_MYCTU (O06628) Exopolysaccharide phosphotransferase cpsY (EC 2.7.-.-)| (Stealth protein cpsY) Length = 532 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +3 Query: 300 PIRKNLSRT----RRLQPTNLKREGWQWPIIYHLTTKHQNSV 413 P+ +LSR + PTN+K G++WP + + H + V Sbjct: 158 PVENSLSRKVLPRNEITPTNVKLYGYKWPTLDGMFAPHASDV 199
>CPSY_MYCBO (Q7U184) Exopolysaccharide phosphotransferase cpsY (EC 2.7.-.-)| (Stealth protein cpsY) Length = 532 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +3 Query: 300 PIRKNLSRT----RRLQPTNLKREGWQWPIIYHLTTKHQNSV 413 P+ +LSR + PTN+K G++WP + + H + V Sbjct: 158 PVENSLSRKVLPRNEITPTNVKLYGYKWPTLDGMFAPHASDV 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,780,439 Number of Sequences: 219361 Number of extensions: 490285 Number of successful extensions: 1128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)