Clone Name | rbastl15h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y2302_MYCBO (P65713) Putative phosphate permease Mb2302 | 28 | 4.5 | 2 | Y2281_MYCTU (P65712) Putative phosphate permease Rv2281/MT2339 | 28 | 4.5 | 3 | CN039_MOUSE (Q9CTN5) Protein C14orf39 homolog | 28 | 4.5 |
---|
>Y2302_MYCBO (P65713) Putative phosphate permease Mb2302| Length = 552 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 5/37 (13%) Frame = -2 Query: 288 IVEMVLFK-----HLGFVICNGLHLIVLVGAGLIWLA 193 IV M+LFK HLG N +I +VGA +W+A Sbjct: 337 IVAMLLFKGFKHMHLGLTTMNNYFIIAMVGAA-VWMA 372
>Y2281_MYCTU (P65712) Putative phosphate permease Rv2281/MT2339| Length = 552 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 5/37 (13%) Frame = -2 Query: 288 IVEMVLFK-----HLGFVICNGLHLIVLVGAGLIWLA 193 IV M+LFK HLG N +I +VGA +W+A Sbjct: 337 IVAMLLFKGFKHMHLGLTTMNNYFIIAMVGAA-VWMA 372
>CN039_MOUSE (Q9CTN5) Protein C14orf39 homolog| Length = 574 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 99 YFATLSELHLEYAAT---IKYASEIKEHEAILTALLTISAQLQL 221 Y L + L+Y+ T KY + KEHE I +L + QLQL Sbjct: 118 YEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQL 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,442,868 Number of Sequences: 219361 Number of extensions: 640711 Number of successful extensions: 1432 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1432 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)