Clone Name | rbastl15g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (O... | 29 | 2.6 | 2 | RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1 | 29 | 3.4 | 3 | VGLP_BEV (P23052) Peplomer glycoprotein precursor | 28 | 5.7 | 4 | RDRP_PVXX3 (P17779) RNA replication protein (165 kDa protein) (O... | 27 | 9.8 | 5 | RDRP_PVX (P09395) RNA replication protein (165 kDa protein) (ORF... | 27 | 9.8 |
---|
>RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +1 Query: 46 GAYNTEL*HQEGTNISKCHWRHKGFR*QTVHQHQNSRKTDTSSHFANLHYKWTFLAGHLA 225 GAY+ E H + + K WR + H N +H + + +F A HL Sbjct: 212 GAYHHEFSHLQSVKVGKIKWRDPK---DGLLGHLNYTHEQVDTHTVTVQLQESFAANHLY 268 Query: 226 LEQRGS 243 +RG+ Sbjct: 269 CIRRGN 274
>RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1| Length = 1269 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 106 SSGI*RCLYLLDVIIQCYMHLTPSFYELVNYV 11 +S I C Y L+ + YM+ TP +E+VN++ Sbjct: 1086 ASNIKACQYTLETLCHMYMNDTPMKFEIVNHM 1117
>VGLP_BEV (P23052) Peplomer glycoprotein precursor| Length = 1581 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 134 TVCYLKPLCLQWHLEMFVPS*CHNSVLYAPDAIF 33 T+C+ P FV C+N+ LY PDA+F Sbjct: 334 TLCFGSPF--------FVAQECYNNALYLPDAVF 359
>RDRP_PVXX3 (P17779) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = +1 Query: 46 GAYNTEL*HQEGTNISKCHWRHKGFR*QTVHQHQNSRKTDTSSHFANLHYKWTFLAGHLA 225 GAY+ E H + + K WR + H N H + + +F A HL Sbjct: 212 GAYHHEFAHLQWLKVGKIKWRDPK---DSFLGHLNYTTEQVEMHTVTVQLQESFAANHLY 268 Query: 226 LEQRG 240 +RG Sbjct: 269 CIRRG 273
>RDRP_PVX (P09395) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = +1 Query: 46 GAYNTEL*HQEGTNISKCHWRHKGFR*QTVHQHQNSRKTDTSSHFANLHYKWTFLAGHLA 225 GAY+ E H + + K WR + H N H + + +F A HL Sbjct: 212 GAYHHEFSHLQWLKVGKIKWRDPK---DSFLGHLNYTTEQVEMHTVTVQLQESFAANHLY 268 Query: 226 LEQRG 240 +RG Sbjct: 269 CIRRG 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,719,751 Number of Sequences: 219361 Number of extensions: 780760 Number of successful extensions: 1668 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1667 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)