Clone Name | rbastl15g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MATK_PSINU (Q8WI35) Maturase K (Intron maturase) | 28 | 7.2 | 2 | CILA_ECOLI (P75726) Citrate lyase alpha chain (EC 4.1.3.6) (Citr... | 27 | 9.4 | 3 | RECG_TREPA (P96130) ATP-dependent DNA helicase recG (EC 3.6.1.-) | 27 | 9.4 |
---|
>MATK_PSINU (Q8WI35) Maturase K (Intron maturase)| Length = 503 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 163 DRLCLRIGPLLFSLGIQLITIMSQQIVPLDCRTSTRTFSQWTGLQAL 303 DR L+I LF + +T++ + I+P++ R + S+W LQ++ Sbjct: 85 DRKNLKINRSLF----EGLTVLFEMIIPVESRPLVQYQSEWNSLQSI 127
>CILA_ECOLI (P75726) Citrate lyase alpha chain (EC 4.1.3.6) (Citrase alpha| chain) (Citrate (pro-3S)-lyase alpha chain) (Citrate CoA-transferase subunit) (EC 2.8.3.10) Length = 510 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 254 AEPAHVHSHSGQVSKHFNSELNL 322 AEP +HSH G+V + ELN+ Sbjct: 138 AEPVQIHSHGGRVHLVQSGELNI 160
>RECG_TREPA (P96130) ATP-dependent DNA helicase recG (EC 3.6.1.-)| Length = 686 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 256 RTSTRTFSQWTGLQALQLRVEPVNLTWGG 342 RT + FSQWT LQ+RV W G Sbjct: 46 RTQEQMFSQWTLAHRLQVRVSVTAHCWFG 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,059,825 Number of Sequences: 219361 Number of extensions: 713429 Number of successful extensions: 1515 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)