Clone Name | rbastl15f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.5 | 2 | SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.5 | 3 | MHPD_ECOLI (P77608) 2-keto-4-pentenoate hydratase (EC 4.2.1.-) (... | 28 | 7.7 |
---|
>SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 99 VLPLQRRNAVHKGHRP 146 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 99 VLPLQRRNAVHKGHRP 146 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>MHPD_ECOLI (P77608) 2-keto-4-pentenoate hydratase (EC 4.2.1.-)| (2-hydroxypentadienoic acid hydratase) Length = 269 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 102 EHIIPRIAVNGN*IQDWNFNLPNKVASQLSC 10 E ++P + V G+ I+DW+ + VA SC Sbjct: 131 EWVLPALEVVGSRIRDWSIQFVDTVADNASC 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,712,787 Number of Sequences: 219361 Number of extensions: 678802 Number of successful extensions: 1721 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)