Clone Name | rbastl15f07 |
---|---|
Clone Library Name | barley_pub |
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -1 Query: 335 YLSILKVNVPGREIPMDAERRISQILGH 252 Y ++LKVNVPGR+ P DA+ R+ +IL H Sbjct: 1026 YSNLLKVNVPGRDTPSDAQSRLLEILSH 1053
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 15 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 188 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4)| Length = 539 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +3 Query: 33 TFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGRYC 200 T R K +I+ N SMRQ + + ++KKP ++ Y E+ YC Sbjct: 423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC 478
>DPO3_CLOTE (Q895K2) DNA polymerase III polC-type (EC 2.7.7.7) (PolIII)| Length = 1427 Score = 28.1 bits (61), Expect = 5.7 Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +3 Query: 9 LKLHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 188 +K P YH +KNK ++N L+S H KKP + Y+E Sbjct: 596 IKKSPTYHVIILVKNKIGLKNLYKLISESH--------LNHFYKKPRMPKSLINKYREGL 647 Query: 189 --GRYCE 203 G CE Sbjct: 648 MIGSACE 654
>SELD_DICDI (Q94497) Selenide, water dikinase (EC 2.7.9.3) (Selenophosphate| synthetase) (Selenium donor protein) (Fragment) Length = 370 Score = 27.7 bits (60), Expect = 7.4 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +3 Query: 30 HTFTRIKNKRSIQNTTNL-----LSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGR 194 H T + + ++TNL L +R +I H LPI +H KK + +N+ +K +G Sbjct: 275 HAATDVTGFGILGHSTNLAQNQLLPIRFEI-HTLPIIKHMKK---LEDHLNHPFKLLKGT 330 Query: 195 YCETS 209 ETS Sbjct: 331 SAETS 335
>RPC1_PLAFA (P27625) DNA-directed RNA polymerase III largest subunit (EC 2.7.7.6)| Length = 2339 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 60 SIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKIN 167 SI ++ LLS + +I YLP +HQ K N NN N Sbjct: 1042 SISSSHLLLSYKNKIP-YLPHVQHQNKTSNMNNIYN 1076 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,431,144 Number of Sequences: 219361 Number of extensions: 589206 Number of successful extensions: 1301 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)