Clone Name | rbastl15e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein | 31 | 0.72 |
---|
>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein| Length = 312 Score = 31.2 bits (69), Expect = 0.72 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 98 HRDGRKENQSVMWLKPPFSLQSLMQLMTCQSIRHDQPQDHVNTDEALLQRK*TDTS 265 HR G+ +N+ V WL+ L L+ ++ + Q + +EA Q + T+TS Sbjct: 80 HRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETS 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,055,866 Number of Sequences: 219361 Number of extensions: 685757 Number of successful extensions: 1252 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1252 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)