Clone Name | rbastl15d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NPC2_ASPFU (Q4X136) Phosphatidylglycerol/phosphatidylinositol tr... | 28 | 4.0 | 2 | PBPB_BUCAI (P57296) Penicillin-binding protein 1B (PBP-1b) (PBP1... | 28 | 6.8 | 3 | YM96_YEAST (Q04893) Hypothetical 113.1 kDa protein in PRE5-FET4 ... | 28 | 6.8 | 4 | REC10_SCHPO (Q09823) Meiotic recombination protein rec10 | 28 | 6.8 | 5 | AROK_SYNEL (Q8DKH7) Shikimate kinase (EC 2.7.1.71) (SK) | 28 | 6.8 |
---|
>NPC2_ASPFU (Q4X136) Phosphatidylglycerol/phosphatidylinositol transfer protein| precursor (PG/PI-TP) Length = 175 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 136 IRHKLDVPLRLCNITSCIPQHKATTNITATADVSCHSPPNNYNRH 270 I+ D+ ++ N+ P K +T D+ H PP YN H Sbjct: 106 IKQTADLCEQIKNVDLECPLEKGEMTLTKQVDLPSHIPPGKYNVH 150
>PBPB_BUCAI (P57296) Penicillin-binding protein 1B (PBP-1b) (PBP1b) (Murein| polymerase) [Includes: Penicillin-insensitive transglycosylase (EC 2.4.1.129) (Peptidoglycan glycosyltransferase) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3. Length = 760 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 111 FYLYRLYFIIIHFFFVLVADVCRFLCL 31 F+ ++ YF+I FFFVL+ +C L L Sbjct: 2 FFNFKKYFLIKVFFFVLILTLCYGLYL 28
>YM96_YEAST (Q04893) Hypothetical 113.1 kDa protein in PRE5-FET4 intergenic| region Length = 1140 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 217 TATADVSCHSPPNNYNRHRR*CPVSRQTNSIGKV 318 T T+ V+C +P NYN + VSR+T +IG V Sbjct: 854 TLTSTVNCSNPTPNYNITKT-VIVSRETTAIGTV 886
>REC10_SCHPO (Q09823) Meiotic recombination protein rec10| Length = 791 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 205 TTNITATADVSCHSPPNN 258 T NIT+ D +C SPPNN Sbjct: 638 TPNITSLLDGTCSSPPNN 655
>AROK_SYNEL (Q8DKH7) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 183 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 385 PRKWARSHHGTVVWIVTP 332 P W+ HHG VVW+ P Sbjct: 93 PMNWSYLHHGIVVWLHVP 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,217,666 Number of Sequences: 219361 Number of extensions: 767250 Number of successful extensions: 2259 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2259 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)